Clone MIP05217 Report

Search the DGRC for MIP05217

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:52
Well:17
Vector:pOT2
Associated Gene/TranscriptCG31008-RA
Protein status:MIP05217.pep: gold
Sequenced Size:516

Clone Sequence Records

MIP05217.complete Sequence

516 bp assembled on 2009-09-15

GenBank Submission: BT099765.1

> MIP05217.complete
TCTAATTCTGCTCGGCTTAAAATATACATAAATTTAAAGCCTGGAAAAGG
GGAGAAAAGATGCCACGCAAACAGAGAAGTGCTTCGGTCAAAGCAGGCTC
TACAAACTATATGCCTGCGGTGGTGCCCACCGTCACGAATTCCGAAATGG
TCTTCAAGGAAGCGGCTGCCCACGCAGTGGGCGTGGCAGCAGGATCAGTC
GTGGGTCATGCCATCGGATCAGGAATAACGGGGCTATTCAGGCGGCGTGA
CCAGCAGCCGCACCACAGCGATTTAGTCGAAGAAGGTCCTTGCGCCAAGG
AAATGAAGGAGTTCTTGAAGTGCACCGAGGACAATGACGATCTCAGTGTG
TGCAAGGAGTTCAACGATGCTGTGCGACGATGCCACCGCCAGTACAATAT
TTAGGAAGCTAGAAAGGGGAAGGGATTTTAATTTGTCAAATTATAAGACG
TTAATGCGCAGCCTTACAAGTAACTCGCAATAAAATTTTAGTTACTAGAA
AAAAAAAAAAAAAAAA

MIP05217.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG31008-RA 530 CG31008-RA 32..530 1..499 2495 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26811986..26812483 498..1 2400 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30989477..30989975 499..1 2495 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30730308..30730806 499..1 2495 100 Minus
Blast to na_te.dros performed 2019-03-15 16:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy3 6973 gypsy3 GYPSY3 6973bp 5271..5347 409..332 108 61.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 5129..5172 22..66 105 73.3 Plus

MIP05217.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:39:06 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26811986..26812483 1..498 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:32 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
CG31008-RA 1..345 60..404 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:37 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
CG31008-RA 1..345 60..404 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:19:41 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
CG31008-RA 1..345 60..404 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:43:57 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
CG31008-RA 1..345 60..404 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-15 17:42:43 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
CG31008-RA 32..529 1..498 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:37 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
CG31008-RA 32..529 1..498 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:19:41 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
CG31008-RA 32..529 1..498 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:43:57 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
CG31008-RA 32..529 1..498 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:06 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30989478..30989975 1..498 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:06 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30989478..30989975 1..498 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:39:06 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30989478..30989975 1..498 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:19:41 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26815200..26815697 1..498 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:45 Download gff for MIP05217.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30730309..30730806 1..498 100   Minus

MIP05217.hyp Sequence

Translation from 59 to 403

> MIP05217.hyp
MPRKQRSASVKAGSTNYMPAVVPTVTNSEMVFKEAAAHAVGVAAGSVVGH
AIGSGITGLFRRRDQQPHHSDLVEEGPCAKEMKEFLKCTEDNDDLSVCKE
FNDAVRRCHRQYNI*

MIP05217.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG31008-PA 114 CG31008-PA 1..114 1..114 599 100 Plus
CG31007-PA 176 CG31007-PA 73..176 32..114 255 51 Plus
CG5010-PA 170 CG5010-PA 37..169 2..114 174 30.8 Plus
CG5010-PB 122 CG5010-PB 18..121 31..114 168 32.7 Plus

MIP05217.pep Sequence

Translation from 59 to 403

> MIP05217.pep
MPRKQRSASVKAGSTNYMPAVVPTVTNSEMVFKEAAAHAVGVAAGSVVGH
AIGSGITGLFRRRDQQPHHSDLVEEGPCAKEMKEFLKCTEDNDDLSVCKE
FNDAVRRCHRQYNI*

MIP05217.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23298-PA 119 GF23298-PA 1..119 1..114 296 58 Plus
Dana\GF23297-PA 182 GF23297-PA 86..182 31..114 217 51.5 Plus
Dana\GF22321-PA 161 GF22321-PA 57..160 31..114 162 32.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11897-PA 114 GG11897-PA 1..114 1..114 467 86 Plus
Dere\GG11896-PA 176 GG11896-PA 91..176 50..114 204 46.5 Plus
Dere\GG19099-PA 169 GG19099-PA 66..168 31..114 156 30.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14350-PA 173 GH14350-PA 55..173 6..114 220 47.2 Plus
Dgri\GH12294-PA 160 GH12294-PA 55..159 31..114 157 31.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG31008-PA 114 CG31008-PA 1..114 1..114 599 100 Plus
CG31007-PA 176 CG31007-PA 73..176 32..114 255 51 Plus
Chchd2-PA 170 CG5010-PA 37..169 2..114 174 30.8 Plus
Chchd2-PB 122 CG5010-PB 18..121 31..114 168 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10444-PA 168 GI10444-PA 74..168 31..114 218 50.5 Plus
Dmoj\GI15541-PA 166 GI15541-PA 61..165 31..114 162 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13971-PA 188 GL13971-PA 86..188 31..114 189 48.5 Plus
Dper\GL15878-PA 161 GL15878-PA 59..160 31..114 158 31.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15932-PA 184 GA15932-PA 82..184 31..114 189 48.5 Plus
Dpse\GA18592-PA 161 GA18592-PA 59..160 31..114 157 31.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12115-PA 114 GM12115-PA 1..114 1..114 422 81.6 Plus
Dsec\GM12113-PA 176 GM12113-PA 91..176 50..114 205 47.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16697-PA 114 GD16697-PA 1..114 1..114 414 80.7 Plus
Dsim\GD16686-PA 174 GD16686-PA 91..174 50..114 206 48.8 Plus
Dsim\GD17330-PA 113 GD17330-PA 11..112 33..114 147 29.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10660-PA 158 GJ10660-PA 66..158 31..114 232 54.8 Plus
Dvir\GJ14883-PA 167 GJ14883-PA 62..166 31..114 159 31.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14164-PA 149 GK14164-PA 54..149 31..114 264 51 Plus
Dwil\GK19777-PA 162 GK19777-PA 58..161 31..114 174 33.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23344-PA 114 GE23344-PA 1..114 1..114 455 82.5 Plus
Dyak\GE23343-PA 171 GE23343-PA 91..171 50..114 196 45.7 Plus
Dyak\GE17645-PA 169 GE17645-PA 66..168 31..114 156 30.1 Plus