Clone MIP05344 Report

Search the DGRC for MIP05344

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:53
Well:44
Vector:pOT2
Associated Gene/TranscriptLcp4-RA
Protein status:MIP05344.pep: gold
Sequenced Size:519

Clone Sequence Records

MIP05344.complete Sequence

519 bp assembled on 2009-10-28

GenBank Submission: BT100177.1

> MIP05344.complete
TCTGACAATCTAACCAAGTCAAAATGTTCAAGATCCTGCTTGTCTGCGCC
CTTGTCGCCCTGGTGGCCGCCAACGAGAATCCCGAGGTCAAGGAGCTGGT
CAACGATGTCCAAGCCGATGGCTTCGTAAGCAAGTTGGTCCTGGACAACG
GTTCCGCTGCTTCTGCTACCGGAGATGTCCACGGAAACATCGACGGAGTT
TTCGAGTGGGTCTCCCCCGAGGGCGAACACGTCCGTGTGAGCTACAAGGC
CGACGAGAACGGATACCAGCCCCAGAGCGACCTCCTGCCCACTCCTCCTC
CAATCCCAGAGGCCATCCTGAAGGCCATCGCCTACATCCAGGCCCATCCC
AGCAAGGAATAAGCAATCGACACGACCAGGACCCACATTCGAATCGGAGG
TGCAACTCCAAAGACCTTGCCCTCTAACCCTTAGAATTTAAACAGCATGC
AGACATTATAAATGATTATCGAGTTAGGAAATAAATTCGATACTCTTTGG
CAAAAAAAAAAAAAAAAAA

MIP05344.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp4-RA 690 Lcp4-RA 17..523 1..507 2520 99.8 Plus
Lcp3-RA 653 Lcp3-RA 160..519 4..363 1050 86.1 Plus
Cpr67Fa1-RA 666 Cpr67Fa1-RA 373..444 248..319 255 90.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4325291..4325756 36..501 2330 100 Plus
chr2R 21145070 chr2R 4323083..4323410 36..363 935 85.7 Plus
chr3L 24539361 chr3L 10881504..10881575 248..319 255 90.3 Plus
chr3L 24539361 chr3L 10883302..10883373 248..319 225 87.5 Plus
chr3L 24539361 chr3L 7078389..7078529 351..211 195 75.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8437765..8438236 36..507 2345 99.8 Plus
2R 25286936 2R 8435557..8435884 36..363 935 85.7 Plus
3L 28110227 3L 10890454..10890525 248..319 255 90.3 Plus
3L 28110227 3L 10892254..10892325 248..319 225 87.5 Plus
3L 28110227 3L 7086166..7086268 351..249 185 78.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8438964..8439435 36..507 2345 99.7 Plus
2R 25260384 2R 8436756..8437083 36..363 935 85.6 Plus
3L 28103327 3L 10883554..10883625 248..319 255 90.2 Plus
3L 28103327 3L 10885354..10885425 248..319 225 87.5 Plus
3L 28103327 3L 7079266..7079368 351..249 185 78.6 Minus
2R 25260384 2R 8438872..8438906 1..35 175 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:04:19 has no hits.

MIP05344.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:05:14 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4325199..4325233 1..35 100 -> Plus
chr2R 4325291..4325756 36..501 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-28 18:17:24 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp4-RA 1..339 24..362 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:47:11 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp4-RA 1..339 24..362 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:36:23 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp4-RA 1..339 24..362 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:42:24 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp4-RA 1..339 24..362 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-28 18:17:23 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp4-RA 17..517 1..501 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:47:11 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp4-RA 17..517 1..501 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:36:23 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp4-RA 27..527 1..501 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:42:24 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp4-RA 27..527 1..501 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:05:14 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8437673..8437707 1..35 100 -> Plus
2R 8437765..8438230 36..501 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:05:14 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8437673..8437707 1..35 100 -> Plus
2R 8437765..8438230 36..501 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:05:14 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8437673..8437707 1..35 100 -> Plus
2R 8437765..8438230 36..501 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:36:23 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4325178..4325212 1..35 100 -> Plus
arm_2R 4325270..4325735 36..501 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:26:57 Download gff for MIP05344.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8438872..8438906 1..35 100 -> Plus
2R 8438964..8439429 36..501 100   Plus

MIP05344.pep Sequence

Translation from 23 to 361

> MIP05344.pep
MFKILLVCALVALVAANENPEVKELVNDVQADGFVSKLVLDNGSAASATG
DVHGNIDGVFEWVSPEGEHVRVSYKADENGYQPQSDLLPTPPPIPEAILK
AIAYIQAHPSKE*

MIP05344.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12356-PA 112 GF12356-PA 1..112 1..112 490 93.8 Plus
Dana\GF12355-PA 112 GF12355-PA 1..111 1..111 448 85.6 Plus
Dana\GF12590-PA 130 GF12590-PA 1..121 1..109 338 52.9 Plus
Dana\GF12589-PA 128 GF12589-PA 31..119 21..109 292 59.6 Plus
Dana\GF10274-PA 119 GF10274-PA 50..119 42..112 206 56.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23356-PA 112 GG23356-PA 1..112 1..112 521 87.5 Plus
Dere\GG23355-PA 112 GG23355-PA 1..111 1..111 446 88.3 Plus
Dere\GG10645-PA 130 GG10645-PA 1..121 1..109 314 49.6 Plus
Dere\GG10643-PA 126 GG10643-PA 1..117 1..109 237 49.6 Plus
Dere\GG15456-PA 134 GG15456-PA 1..117 1..109 228 40.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20994-PA 124 GH20994-PA 1..119 1..111 322 53.8 Plus
Dgri\GH20893-PA 265 GH20893-PA 146..261 5..112 300 49.1 Plus
Dgri\GH20812-PA 117 GH20812-PA 1..101 1..104 231 45.8 Plus
Dgri\GH16160-PA 120 GH16160-PA 1..113 1..109 209 37.7 Plus
Dgri\GH15299-PA 118 GH15299-PA 1..117 1..111 197 39.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp4-PB 112 CG2044-PB 1..112 1..112 577 100 Plus
Lcp4-PA 112 CG2044-PA 1..112 1..112 577 100 Plus
Lcp3-PB 112 CG2043-PB 1..111 1..111 512 88.3 Plus
Lcp3-PA 112 CG2043-PA 1..111 1..111 512 88.3 Plus
Lcp1-PB 130 CG11650-PB 1..121 1..109 310 48.8 Plus
Lcp1-PA 130 CG11650-PA 1..121 1..109 310 48.8 Plus
Lcp2-PB 126 CG8697-PB 1..117 1..109 298 48.7 Plus
Lcp2-PA 126 CG8697-PA 1..117 1..109 298 48.7 Plus
Cpr67Fa1-PA 134 CG7941-PA 1..117 1..109 241 46.2 Plus
Cpr67Fa2-PA 134 CG18349-PA 1..117 1..109 240 46.2 Plus
Cpr78Cc-PA 119 CG7658-PA 1..116 1..109 222 45.8 Plus
Cpr65Ea-PA 127 CG8640-PA 1..115 1..112 207 41.7 Plus
Cpr47Eg-PA 117 CG9070-PA 3..117 2..112 205 42.2 Plus
Edg78E-PB 122 CG7673-PB 1..113 1..109 202 38.6 Plus
Edg78E-PA 122 CG7673-PA 1..113 1..109 202 38.6 Plus
Cpr67Fb-PA 122 CG18348-PA 1..114 1..109 191 40.4 Plus
Cpr65Eb-PA 179 CG8638-PA 6..124 4..112 182 34.5 Plus
Cpr65Ec-PA 127 CG8634-PA 4..119 2..112 181 37.1 Plus
Cpr49Aa-PB 144 CG30045-PB 78..129 58..109 177 61.5 Plus
Cpr49Af-PB 126 CG8510-PB 4..120 4..111 169 35 Plus
Cpr49Af-PA 126 CG8510-PA 4..120 4..111 169 35 Plus
Cpr47Ef-PD 601 CG13214-PD 136..226 22..103 153 38.5 Plus
Cpr47Ef-PC 612 CG13214-PC 136..226 22..103 153 38.5 Plus
Cpr65Az-PA 239 CG12330-PA 134..211 24..107 151 38.4 Plus
Cpr49Ae-PA 134 CG8505-PA 13..129 5..109 148 35 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20906-PA 117 GI20906-PA 1..115 1..112 321 58.3 Plus
Dmoj\GI20903-PA 122 GI20903-PA 1..117 1..109 302 51.3 Plus
Dmoj\GI20904-PA 119 GI20904-PA 1..114 1..109 295 50.9 Plus
Dmoj\GI20905-PA 121 GI20905-PA 1..114 1..109 284 49.1 Plus
Dmoj\GI20899-PA 150 GI20899-PA 1..135 1..109 261 41.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22414-PA 112 GL22414-PA 1..112 1..112 406 79.5 Plus
Dper\GL20440-PA 112 GL20440-PA 1..112 1..112 406 79.5 Plus
Dper\GL11219-PA 112 GL11219-PA 1..112 1..112 405 78.6 Plus
Dper\GL10863-PA 126 GL10863-PA 29..117 21..109 306 61.8 Plus
Dper\GL10864-PA 137 GL10864-PA 1..109 1..91 230 44 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15201-PA 112 GA15201-PA 1..112 1..112 405 78.6 Plus
Dpse\GA24647-PA 112 GA24647-PA 1..112 1..112 405 78.6 Plus
Dpse\GA21266-PA 126 GA21266-PA 29..117 21..109 315 62.9 Plus
Dpse\GA24514-PA 138 GA24514-PA 1..127 1..109 303 47.2 Plus
Dpse\GA20507-PA 120 GA20507-PA 1..116 1..109 207 43.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21031-PA 112 GM21031-PA 1..112 1..112 581 100 Plus
Dsec\GM21030-PA 112 GM21030-PA 1..111 1..111 382 90.1 Plus
Dsec\GM20690-PA 130 GM20690-PA 1..121 1..109 316 48.8 Plus
Dsec\GM20688-PA 126 GM20688-PA 1..117 1..109 303 49.6 Plus
Dsec\GM22150-PA 122 GM22150-PA 1..113 1..109 208 38.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10560-PA 112 GD10560-PA 1..112 1..112 573 98.2 Plus
Dsim\GD22274-PA 112 GD22274-PA 1..112 1..112 573 98.2 Plus
Dsim\GD10559-PA 112 GD10559-PA 1..111 1..111 377 89.2 Plus
Dsim\GD10171-PA 130 GD10171-PA 1..121 1..109 317 49.6 Plus
Dsim\GD14266-PA 116 GD14266-PA 1..116 1..108 220 42.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20637-PA 117 GJ20637-PA 1..114 1..111 335 59.6 Plus
Dvir\GJ20634-PA 126 GJ20634-PA 1..117 1..109 293 50.4 Plus
Dvir\GJ20635-PA 117 GJ20635-PA 1..114 6..111 265 47.4 Plus
Dvir\GJ21708-PA 131 GJ21708-PA 34..122 21..109 264 57.3 Plus
Dvir\GJ21116-PA 156 GJ21116-PA 22..138 1..112 254 46.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21499-PA 114 GK21499-PA 1..112 1..112 379 70.5 Plus
Dwil\GK21498-PA 112 GK21498-PA 1..112 1..112 354 71.4 Plus
Dwil\GK21497-PA 112 GK21497-PA 1..110 1..112 308 68.8 Plus
Dwil\GK21815-PA 129 GK21815-PA 1..123 1..112 306 47.2 Plus
Dwil\GK21874-PA 192 GK21874-PA 104..182 34..112 222 55 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19198-PA 112 GE19198-PA 1..112 1..112 559 96.4 Plus
Dyak\GE19197-PA 112 GE19197-PA 1..111 1..111 408 89.2 Plus
Dyak\GE19195-PA 112 GE19195-PA 1..111 1..111 408 89.2 Plus
Dyak\GE23045-PA 130 GE23045-PA 1..122 1..110 305 47.5 Plus
Dyak\GE23024-PA 126 GE23024-PA 1..117 1..109 293 47.9 Plus

MIP05344.hyp Sequence

Translation from 23 to 361

> MIP05344.hyp
MFKILLVCALVALVAANENPEVKELVNDVQADGFVSKLVLDNGSAASATG
DVHGNIDGVFEWVSPEGEHVRVSYKADENGYQPQSDLLPTPPPIPEAILK
AIAYIQAHPSKE*

MIP05344.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp4-PB 112 CG2044-PB 1..112 1..112 577 100 Plus
Lcp4-PA 112 CG2044-PA 1..112 1..112 577 100 Plus
Lcp3-PB 112 CG2043-PB 1..111 1..111 512 88.3 Plus
Lcp3-PA 112 CG2043-PA 1..111 1..111 512 88.3 Plus
Lcp1-PB 130 CG11650-PB 1..121 1..109 310 48.8 Plus