Clone MIP05401 Report

Search the DGRC for MIP05401

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:54
Well:1
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG17770-RA
Protein status:MIP05401.pep: gold
Sequenced Size:1242

Clone Sequence Records

MIP05401.complete Sequence

1242 bp assembled on 2009-02-17

GenBank Submission: BT059795.1

> MIP05401.complete
AACTAAAGTTTGTCGAAAATTTGTAGTGAGTGTTCAGTGACCCCAAAATT
TTCCCACCCCCAACCCCTTCCTTTGGCCATGGATTTCGAATTCCTTACTC
CGCCGCCAGAGGAACGGACCATTCGCACCCACAATCTGACCGAAGAACAG
GTCAAGGATTTGGAGATTGCCTTTTCCCTGTTTGACGACCAAGACACTAA
GGTTATTCCTATAACAAATCTCAGGCAACTAATGCTGTCTGTGGCCCACT
ATCCCAGTGATATGGAATTGCAGGAAATTCAGGCCGAGATCGATGCTGAT
GGATCCGGTGAGTTATATCTCAGCGATTTCCTTCACATCATGTCTCAGAG
GTACGCAAACATGTCTACCGAGGATGAAATTATAGCTGCATTCAGAGTCT
TTGACAAAGAAGGAACCGGCTTAATATCTGAATCGGAATTTCGTCACATA
ATGCAGAACATGGGGGAGCAATTGACGGATGATGAGGTGGAGGAGATCAT
CCGTGATGCAAATTCTGATTTGGAAGGCAATATAGACTATGTGCGATTTG
TCAGAATGATGTCCACTACATAAGGAAAAAGCAGGCTTTAGGGGTTGGGA
ACCCGACCTGTCAGTATCAGTATCATCAAAACAGTTTCGGCTCATTCCCT
TTCGTAAATTCCAACAGTCTATAGCTCTGCAAGCATTTAAAAATATCTCG
ATAAATACCGAAAATCTTTGAAAATTTATCAAGATGTCCGAACTAACGGA
GGAGCAGATTGCCGAGTTCAAGGATGCCTTTGTCCAGTTCGACAAGGAGG
GAACCGGCAAGATCGCCACCCGTGAGCTGGGCACATTGATGCGCACCTTG
GGCCAGAATCCAACGGAGGCCGAGTTGCAAGATTTGATAGCTGAGGCCGA
GAACAACAACAATGGCCAACTGAACTTCACTGAGTTCTGCGGTATAATGG
CCAAGCAAATGCGGGAAACTGACACTGAGGAGGAAATGCGTGAGGCATTC
AAGATTTTTGATCGTGATGGCGATGGCTTTATATCACCAGCTGAGCTTCG
CTTTGTGATGATCAATCTGGGCGAAAAGGTCACCGACGAGGAGATCGATG
AGATGATTCGCGAGGCTGATTTTGATGGGGATGGCATGATCAACTACGAG
GAATTCGTATGGATGATAAGCCAGAAGTAGTACAGCTACTTTAAATGAAA
TAAAAATATTTGGGGTCACTGCATAAAAAAAAAAAAAAAAAA

MIP05401.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
And-RB 1224 And-RB 1..1224 1..1224 6120 100 Plus
CG17770-RA 1224 CG17770-RA 1..1224 1..1224 6120 100 Plus
And-RA 664 And-RA 1..604 629..1232 3020 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21634885..21636104 1..1224 5995 99.5 Plus
chr3R 27901430 chr3R 21634390..21634532 284..426 205 76.2 Plus
chr2R 21145070 chr2R 8156558..8156631 1055..1128 205 85.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25811911..25813142 1..1232 6160 100 Plus
2R 25286936 2R 12269339..12269412 1055..1128 205 85.1 Plus
3R 32079331 3R 25811413..25811555 284..426 190 75.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25552742..25553973 1..1232 6160 100 Plus
2R 25260384 2R 12270538..12270611 1055..1128 205 85.1 Plus
2R 25260384 2R 12266032..12266087 824..879 160 85.7 Plus
Blast to na_te.dros performed on 2019-03-16 06:56:15 has no hits.

MIP05401.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:57:06 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21634885..21636104 1..1224 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:43 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
CG17770-RA 1..495 79..573 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:56 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
CG17770-RA 1..495 79..573 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:20:55 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
CG17770-RA 1..495 79..573 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:26:04 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
CG17770-RA 1..495 79..573 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-17 18:01:11 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
And-RA 1..596 629..1224 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:56 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
CG17770-RA 1..1224 1..1224 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:20:55 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
CG17770-RA 1..1224 1..1224 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:26:04 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
CG17770-RA 1..1224 1..1224 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:57:06 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25811911..25813134 1..1224 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:57:06 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25811911..25813134 1..1224 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:57:06 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25811911..25813134 1..1224 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:20:55 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21637633..21638856 1..1224 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:08:16 Download gff for MIP05401.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25552742..25553965 1..1224 100   Plus

MIP05401.pep Sequence

Translation from 78 to 572

> MIP05401.pep
MDFEFLTPPPEERTIRTHNLTEEQVKDLEIAFSLFDDQDTKVIPITNLRQ
LMLSVAHYPSDMELQEIQAEIDADGSGELYLSDFLHIMSQRYANMSTEDE
IIAAFRVFDKEGTGLISESEFRHIMQNMGEQLTDDEVEEIIRDANSDLEG
NIDYVRFVRMMSTT*

MIP05401.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16771-PA 165 GF16771-PA 1..165 1..164 614 70.3 Plus
Dana\GF16770-PA 165 GF16770-PA 3..165 2..163 520 62 Plus
Dana\GF12835-PA 149 GF12835-PA 5..148 20..163 338 45.1 Plus
Dana\GF16772-PA 148 GF16772-PA 2..146 18..162 273 38.6 Plus
Dana\GF22746-PA 184 GF22746-PA 37..181 20..164 268 36.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11424-PA 164 GG11424-PA 1..164 1..164 754 86 Plus
Dere\GG11423-PA 165 GG11423-PA 3..165 2..164 489 61.3 Plus
Dere\GG20265-PA 149 GG20265-PA 5..148 20..163 338 45.1 Plus
Dere\GG11425-PA 148 GG11425-PA 4..146 20..162 286 39.9 Plus
Dere\GG21382-PA 182 GG21382-PA 35..179 20..164 240 34.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23399-PA 166 GH23399-PA 1..164 1..162 435 54.9 Plus
Dgri\GH23405-PA 151 GH23405-PA 6..149 19..162 277 38.9 Plus
Dgri\GH10976-PA 190 GH10976-PA 43..187 20..164 275 37.9 Plus
Dgri\GH23794-PA 186 GH23794-PA 27..183 8..164 229 32.5 Plus
Dgri\GH10538-PA 186 GH10538-PA 27..183 8..164 229 32.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG17770-PA 164 CG17770-PA 1..164 1..164 833 100 Plus
CG5024-PB 165 CG5024-PB 3..165 2..164 516 58.9 Plus
CG5024-PA 165 CG5024-PA 3..165 2..164 516 58.9 Plus
Cam-PD 149 CG8472-PD 5..148 20..163 337 45.1 Plus
Cam-PC 149 CG8472-PC 5..148 20..163 337 45.1 Plus
Cam-PE 149 CG8472-PE 5..148 20..163 337 45.1 Plus
Cam-PB 149 CG8472-PB 5..148 20..163 337 45.1 Plus
Cam-PA 149 CG8472-PA 5..148 20..163 337 45.1 Plus
Acam-PB 148 CG17769-PB 4..146 20..162 290 39.9 Plus
Acam-PA 148 CG17769-PA 4..146 20..162 290 39.9 Plus
CG17493-PD 182 CG17493-PD 35..179 20..164 249 34.5 Plus
CG17493-PC 182 CG17493-PC 35..179 20..164 249 34.5 Plus
CG17493-PB 182 CG17493-PB 35..179 20..164 249 34.5 Plus
CG31960-PA 148 CG31960-PA 4..147 20..163 240 33.3 Plus
azot-PA 148 CG11165-PA 7..146 22..162 227 30.5 Plus
CG31802-PA 186 CG31802-PA 36..183 17..164 224 31.8 Plus
CG11638-PA 387 CG11638-PA 206..355 20..161 218 33.1 Plus
CG30378-PA 148 CG30378-PA 4..146 19..161 215 28 Plus
Mlc-c-PA 147 CG3201-PA 5..144 21..161 211 32.2 Plus
TpnC41C-PB 154 CG2981-PB 5..150 20..162 208 30.8 Plus
TpnC41C-PA 154 CG2981-PA 5..150 20..162 208 30.8 Plus
CG13898-PA 151 CG13898-PA 8..145 20..157 206 29.7 Plus
TpnC73F-PC 155 CG7930-PC 7..153 19..162 203 33.1 Plus
TpnC73F-PA 155 CG7930-PA 7..153 19..162 203 33.1 Plus
TpnC47D-PB 155 CG9073-PB 7..153 19..162 202 33.8 Plus
TpnC47D-PA 155 CG9073-PA 7..153 19..162 202 33.8 Plus
Mlc-c-PB 153 CG3201-PB 15..150 25..161 196 30.9 Plus
Eip63F-1-PC 181 CG15855-PC 13..180 13..161 181 27.4 Plus
Eip63F-1-PA 193 CG15855-PA 25..192 13..161 181 27.4 Plus
TpnC25D-PC 149 CG6514-PC 4..147 22..162 173 26.9 Plus
TpnC25D-PA 149 CG6514-PA 4..147 22..162 173 26.9 Plus
Eip63F-1-PD 166 CG15855-PD 3..165 18..161 173 28.2 Plus
CG13526-PA 154 CG13526-PA 7..150 18..161 172 25.7 Plus
TpnC25D-PB 143 CG6514-PB 7..141 31..162 169 27.9 Plus
CG17272-PA 149 CG17272-PA 7..140 22..160 165 30.9 Plus
sqh-PE 174 CG3595-PE 30..164 22..161 162 27.1 Plus
sqh-PD 174 CG3595-PD 30..164 22..161 162 27.1 Plus
sqh-PC 174 CG3595-PC 30..164 22..161 162 27.1 Plus
sqh-PB 174 CG3595-PB 30..164 22..161 162 27.1 Plus
sqh-PA 174 CG3595-PA 30..164 22..161 162 27.1 Plus
Eip63F-1-PB 161 CG15855-PB 6..160 26..161 155 27.7 Plus
Mlc2-PA 222 CG2184-PA 73..211 21..162 149 28.3 Plus
TpnC4-PB 153 CG12408-PB 8..152 22..162 147 24 Plus
TpnC4-PA 153 CG12408-PA 8..152 22..162 147 24 Plus
CG33098-PF 230 CG33098-PF 62..222 7..162 144 27.3 Plus
CG33098-PE 230 CG33098-PE 62..222 7..162 144 27.3 Plus
CG33098-PB 230 CG33098-PB 62..222 7..162 144 27.3 Plus
CG33098-PD 164 CG33098-PD 7..156 15..162 142 26.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes120-PA 166 GI10338-PA 3..164 1..162 487 56.2 Plus
Dmoj\GI20594-PA 149 GI20594-PA 5..148 20..163 338 45.1 Plus
Dmoj\GI10339-PA 149 GI10339-PA 4..147 19..162 296 38.9 Plus
Dmoj\GI10340-PA 150 GI10340-PA 5..148 19..162 267 37.5 Plus
Dmoj\GI17489-PA 205 GI17489-PA 58..202 20..164 253 35.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21534-PA 165 GL21534-PA 4..163 3..162 540 60.6 Plus
Dper\GL10814-PA 149 GL10814-PA 5..148 20..163 338 45.1 Plus
Dper\GL21535-PA 148 GL21535-PA 4..146 20..162 282 39.2 Plus
Dper\GL21536-PA 148 GL21536-PA 4..146 20..162 274 38.5 Plus
Dper\GL11701-PA 148 GL11701-PA 3..147 19..163 269 39.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26321-PA 165 GA26321-PA 4..163 3..162 540 60.6 Plus
Dpse\GA24499-PA 149 GA24499-PA 5..148 20..163 338 45.1 Plus
Dpse\GA14657-PA 148 GA14657-PA 4..146 20..162 283 39.2 Plus
Dpse\GA26322-PA 148 GA26322-PA 4..146 20..162 274 38.5 Plus
Dpse\GA10810-PA 148 GA10810-PA 3..147 19..163 267 38.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10264-PA 164 GM10264-PA 1..164 1..164 824 97 Plus
Dsec\GM10263-PA 165 GM10263-PA 3..165 2..164 482 60.1 Plus
Dsec\GM21351-PA 149 GM21351-PA 5..148 20..163 338 45.1 Plus
Dsec\GM10265-PA 148 GM10265-PA 4..146 20..162 290 39.9 Plus
Dsec\GM19287-PA 182 GM19287-PA 35..179 20..164 240 34.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21234-PA 164 GD21234-PA 1..164 1..164 831 97.6 Plus
Dsim\GD21233-PA 165 GD21233-PA 3..165 2..164 482 60.1 Plus
Dsim\GD10849-PA 149 GD10849-PA 5..148 20..163 338 45.1 Plus
Dsim\GD21235-PA 148 GD21235-PA 4..146 20..162 290 39.9 Plus
Dsim\GD10523-PA 148 GD10523-PA 15..146 31..162 219 29.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10192-PA 166 GJ10192-PA 4..164 2..162 481 57.8 Plus
Dvir\GJ20779-PA 113 GJ20779-PA 1..112 52..163 283 46.4 Plus
Dvir\GJ15110-PA 190 GJ15110-PA 43..187 20..164 279 38.6 Plus
Dvir\GJ10193-PA 151 GJ10193-PA 6..149 19..162 269 36.8 Plus
Dvir\GJ19846-PA 184 GJ19846-PA 29..181 12..164 236 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18987-PA 167 GK18987-PA 4..165 2..162 486 58.6 Plus
Dwil\GK22183-PA 149 GK22183-PA 5..148 20..163 338 45.1 Plus
Dwil\GK18988-PA 148 GK18988-PA 4..146 20..162 312 41.3 Plus
Dwil\GK15343-PA 197 GK15343-PA 50..194 20..164 276 37.9 Plus
Dwil\GK21975-PA 147 GK21975-PA 4..142 20..158 244 34.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23619-PA 164 GE23619-PA 1..164 1..164 753 85.4 Plus
Dyak\GE23617-PA 165 GE23617-PA 3..165 2..164 496 63.2 Plus
Dyak\Cam-PA 149 GE12425-PA 5..148 20..163 338 45.1 Plus
Dyak\GE23620-PA 148 GE23620-PA 4..146 20..162 293 41.3 Plus
Dyak\GE22671-PA 182 GE22671-PA 35..179 20..164 236 33.8 Plus

MIP05401.hyp Sequence

Translation from 78 to 572

> MIP05401.hyp
MDFEFLTPPPEERTIRTHNLTEEQVKDLEIAFSLFDDQDTKVIPITNLRQ
LMLSVAHYPSDMELQEIQAEIDADGSGELYLSDFLHIMSQRYANMSTEDE
IIAAFRVFDKEGTGLISESEFRHIMQNMGEQLTDDEVEEIIRDANSDLEG
NIDYVRFVRMMSTT*

MIP05401.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG17770-PA 164 CG17770-PA 1..164 1..164 833 100 Plus
CG5024-PB 165 CG5024-PB 3..165 2..164 516 58.9 Plus
CG5024-PA 165 CG5024-PA 3..165 2..164 516 58.9 Plus
Cam-PD 149 CG8472-PD 5..148 20..163 337 45.1 Plus
Cam-PC 149 CG8472-PC 5..148 20..163 337 45.1 Plus