Clone MIP05430 Report

Search the DGRC for MIP05430

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:54
Well:30
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG8534-RA
Protein status:MIP05430.pep: gold
Sequenced Size:1016

Clone Sequence Records

MIP05430.complete Sequence

1016 bp assembled on 2009-10-08

GenBank Submission: BT099987.1

> MIP05430.complete
GTTGCCAGTGAAACATTACCTCGAGTGGAAGCGGATTGACTTTAGATTTT
CGTTTAGAATGGCCGATTTACTCAATGGAACCCTAATCATTTCGGAGGAT
CCTGTCCGCCTGCCACTCATCGGAAGTCCATGGCCATCGCTGACCATCGT
TTCGCTCTATCTGCTGTTTGTCTTGAAGTTAGGCAGGAAGTTCATGGAGA
ACAGAAAGCCCTACGATCTCCGCAGAGTCATCAGGGCATACAACATTATG
CAGATTGTCTACAACGGCGTTATTCTGATAGCGGGTCTTCACTTTTTGTT
CGTCCTGAAGGCCTACGACCTGCGATGCATCACCAAACTGCCGCTGGATC
ACGAGCTGAAGAGCCGAGAAAGATGGTTGACCTACTCGTACTTCTTCAAC
AAGTTCATGGATCTGCTGGAGACTGTGTTCTTTGTGCTGCGCAAGAAGGA
TCGCCAGATATCCTTCCTGCACGTCTTCCACCACCTGGTGATGTCCTTTG
GCGGATACCTGCACATTACCTTCAACGGCTATGGAGGCACTCTGTTCCCA
TTATGCCTGCTCAATGTGGCGGTCCATGTGATCATGTACGCCTACTACTA
CCTGTCCTCCGTCAGCAAGGATGTGCAGACGAGTCGGTGGAAGAAGTACA
TCACCATTGTCCAGCTGGTCCAGTTCATCCTGGTGCTGGCGAACTTTAGC
TACACCCTGATGCAGCCCGATTGCAATGCCTCCCGAACTGTGATATATAC
TGGCATGTTCATTTCCACGACCTTCATCCTGATGTTTGCCAACTTCTACA
TTCACAACTACATACTGAATGGAAGCAAACAGAAGAGCGCGTTGAAATCC
GATTGAGGCCGCAAATCCTTTGAATGACGGTGACTGTGTGTTTCGCGATA
CCGACTAACTAATAAACTTGCATTGGAGCACTCAGCACCAAGACTCTACT
GGGCACCGTATTCACAGCTATCTCAGCACTAGCCCTGGCCAAAAAAAAAA
AAAAAAAAAAAAAAAA

MIP05430.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8534-RA 1283 CG8534-RA 172..1163 1..992 4960 100 Plus
CG9458-RA 1046 CG9458-RA 427..585 326..484 390 83 Plus
eloF-RA 1075 eloF-RA 652..759 572..676 275 85.1 Plus
eloF-RA 1075 eloF-RA 508..560 428..480 190 90.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5639051..5639758 283..990 3540 100 Plus
chr3R 27901430 chr3R 5638566..5638849 1..284 1420 100 Plus
chr3R 27901430 chr3R 5645195..5645353 484..326 390 83 Minus
chr3R 27901430 chr3R 5643690..5643848 484..326 360 81.8 Minus
chr3R 27901430 chr3R 5640411..5640662 428..676 340 76.6 Plus
chr3R 27901430 chr3R 18356700..18356784 484..400 215 83.5 Minus
chr3R 27901430 chr3R 18379052..18379135 401..484 195 82.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9813232..9813941 283..992 3550 100 Plus
3R 32079331 3R 9812747..9813030 1..284 1420 100 Plus
3R 32079331 3R 9819375..9819533 484..326 390 83 Minus
3R 32079331 3R 9817871..9818029 484..326 360 81.8 Minus
3R 32079331 3R 9814592..9814843 428..676 355 77 Plus
3R 32079331 3R 22533152..22533236 484..400 215 83.5 Minus
3R 32079331 3R 22555518..22555601 401..484 195 82.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9554063..9554772 283..992 3550 100 Plus
3R 31820162 3R 9553578..9553861 1..284 1420 100 Plus
3R 31820162 3R 9560206..9560364 484..326 390 83 Minus
3R 31820162 3R 9558702..9558803 484..383 345 89.2 Minus
3R 31820162 3R 9555567..9555674 572..676 275 85.1 Plus
3R 31820162 3R 22273983..22274067 484..400 215 83.5 Minus
3R 31820162 3R 22296349..22296432 401..484 195 82.1 Plus
3R 31820162 3R 9555423..9555475 428..480 190 90.5 Plus
3R 31820162 3R 22296584..22296629 636..681 140 86.9 Plus
Blast to na_te.dros performed on 2019-03-16 07:41:54 has no hits.

MIP05430.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:42:33 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5638566..5638848 1..283 100 -> Plus
chr3R 5639052..5639758 284..990 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:57:07 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
CG8534-RA 1..798 59..856 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:41:54 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
CG8534-RA 1..798 59..856 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:01:56 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
CG8534-RA 1..798 59..856 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:52 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
CG8534-RA 1..798 59..856 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-08 17:58:22 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
CG8534-RA 1..818 39..856 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:41:54 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
CG8534-RA 1..990 1..990 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:01:56 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
CG8534-RA 1..990 1..990 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:52 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
CG8534-RA 1..990 1..990 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:33 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9812747..9813029 1..283 100 -> Plus
3R 9813233..9813939 284..990 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:33 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9812747..9813029 1..283 100 -> Plus
3R 9813233..9813939 284..990 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:33 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9812747..9813029 1..283 100 -> Plus
3R 9813233..9813939 284..990 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:01:56 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5638469..5638751 1..283 100 -> Plus
arm_3R 5638955..5639661 284..990 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:23:24 Download gff for MIP05430.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9553578..9553860 1..283 100 -> Plus
3R 9554064..9554770 284..990 100   Plus

MIP05430.hyp Sequence

Translation from 0 to 855

> MIP05430.hyp
LPVKHYLEWKRIDFRFSFRMADLLNGTLIISEDPVRLPLIGSPWPSLTIV
SLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLF
VLKAYDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKD
RQISFLHVFHHLVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYY
LSSVSKDVQTSRWKKYITIVQLVQFILVLANFSYTLMQPDCNASRTVIYT
GMFISTTFILMFANFYIHNYILNGSKQKSALKSD*

MIP05430.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG8534-PA 265 CG8534-PA 1..265 20..284 1377 100 Plus
eloF-PA 257 CG16905-PA 6..257 33..283 793 59.1 Plus
CG9458-PA 264 CG9458-PA 15..254 33..271 710 56.2 Plus
CG9459-PA 265 CG9459-PA 5..263 20..281 709 53.2 Plus
CG16904-PA 262 CG16904-PA 11..250 33..271 682 54.6 Plus

MIP05430.pep Sequence

Translation from 1 to 855

> MIP05430.pep
LPVKHYLEWKRIDFRFSFRMADLLNGTLIISEDPVRLPLIGSPWPSLTIV
SLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLF
VLKAYDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKD
RQISFLHVFHHLVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYY
LSSVSKDVQTSRWKKYITIVQLVQFILVLANFSYTLMQPDCNASRTVIYT
GMFISTTFILMFANFYIHNYILNGSKQKSALKSD*

MIP05430.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15497-PA 253 GF15497-PA 6..253 33..279 735 56 Plus
Dana\GF15498-PA 253 GF15498-PA 6..253 33..279 680 52.8 Plus
Dana\GF13996-PA 269 GF13996-PA 8..253 33..277 669 52.4 Plus
Dana\GF22463-PA 260 GF22463-PA 6..251 33..277 649 52.4 Plus
Dana\GF15499-PA 244 GF15499-PA 3..239 42..277 607 54.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17214-PA 265 GG17214-PA 1..265 20..284 1094 76.2 Plus
Dere\GG17320-PA 260 GG17320-PA 11..250 33..271 681 54.6 Plus
Dere\GG17318-PA 264 GG17318-PA 2..264 20..281 656 52.5 Plus
Dere\GG17319-PA 264 GG17319-PA 5..263 20..280 638 51.1 Plus
Dere\GG11234-PA 253 GG11234-PA 10..253 32..278 605 47 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22831-PA 416 GH22831-PA 186..416 53..282 596 49.4 Plus
Dgri\GH19804-PA 261 GH19804-PA 11..260 33..280 566 44.4 Plus
Dgri\GH19803-PA 217 GH19803-PA 1..209 65..271 411 41.1 Plus
Dgri\GH22831-PA 416 GH22831-PA 9..181 31..203 409 48 Plus
Dgri\GH17398-PA 285 GH17398-PA 32..262 39..270 382 37.2 Plus
Dgri\GH18331-PA 339 GH18331-PA 56..306 33..282 357 35.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG8534-PA 265 CG8534-PA 1..265 20..284 1377 100 Plus
eloF-PA 257 CG16905-PA 6..257 33..283 793 59.1 Plus
CG9458-PA 264 CG9458-PA 15..254 33..271 710 56.2 Plus
CG9459-PA 265 CG9459-PA 5..263 20..281 709 53.2 Plus
CG16904-PA 262 CG16904-PA 11..250 33..271 682 54.6 Plus
CG31141-PA 253 CG31141-PA 11..246 33..271 613 49.4 Plus
CG18609-PA 263 CG18609-PA 11..251 33..271 582 46.9 Plus
CG17821-PA 262 CG17821-PA 2..262 17..278 546 42 Plus
CG6660-PA 272 CG6660-PA 24..258 37..271 432 38.1 Plus
bond-PC 322 CG6921-PC 28..257 39..270 387 37.8 Plus
bond-PA 322 CG6921-PA 28..257 39..270 387 37.8 Plus
bond-PB 322 CG6921-PB 28..257 39..270 387 37.8 Plus
CG5326-PA 277 CG5326-PA 32..277 39..284 386 36.1 Plus
CG2781-PA 329 CG2781-PA 27..272 38..284 379 34.5 Plus
CG31522-PF 365 CG31522-PF 27..269 38..281 358 33.1 Plus
CG31522-PB 365 CG31522-PB 27..269 38..281 358 33.1 Plus
CG31522-PD 365 CG31522-PD 27..269 38..281 358 33.1 Plus
CG31522-PH 364 CG31522-PH 27..268 38..281 356 33.5 Plus
CG31522-PG 364 CG31522-PG 27..268 38..281 356 33.5 Plus
CG31522-PA 364 CG31522-PA 27..268 38..281 356 33.5 Plus
sit-PA 295 CG5278-PA 29..264 39..282 352 37 Plus
CG33110-PA 337 CG33110-PA 59..292 36..270 350 34.6 Plus
CG30008-PA 266 CG30008-PA 13..257 35..280 336 34.7 Plus
CG31522-PI 392 CG31522-PI 27..296 38..281 336 30.5 Plus
CG31523-PF 354 CG31523-PF 29..272 39..284 321 30.2 Plus
CG31523-PE 354 CG31523-PE 29..272 39..284 321 30.2 Plus
CG31523-PG 354 CG31523-PG 29..272 39..284 321 30.2 Plus
CG31523-PD 354 CG31523-PD 29..272 39..284 321 30.2 Plus
CG31523-PA 354 CG31523-PA 29..272 39..284 321 30.2 Plus
CG31523-PB 354 CG31523-PB 29..272 39..284 321 30.2 Plus
CG31523-PC 354 CG31523-PC 29..272 39..284 321 30.2 Plus
Elo68beta-PB 269 CG11801-PB 14..268 16..279 301 30.5 Plus
Elo68alpha-PA 262 CG32072-PA 23..260 38..278 278 30.7 Plus
Baldspot-PB 316 CG3971-PB 44..267 52..274 164 26.7 Plus
Baldspot-PA 316 CG3971-PA 44..267 52..274 164 26.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10225-PA 258 GI10225-PA 9..258 31..278 658 49.6 Plus
Dmoj\GI10223-PA 260 GI10223-PA 11..260 33..284 606 48.6 Plus
Dmoj\GI20344-PA 262 GI20344-PA 1..254 20..271 539 41.7 Plus
Dmoj\GI20347-PA 245 GI20347-PA 1..244 38..279 524 44.3 Plus
Dmoj\GI20345-PA 249 GI20345-PA 6..247 38..277 515 43 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23222-PA 264 GL23222-PA 1..257 20..276 734 57.7 Plus
Dper\GL23223-PA 262 GL23223-PA 10..262 32..284 690 52.8 Plus
Dper\GL11311-PA 284 GL11311-PA 8..252 29..271 548 44.5 Plus
Dper\GL11310-PA 263 GL11310-PA 13..262 30..277 515 45.6 Plus
Dper\GL13683-PA 277 GL13683-PA 32..269 39..277 386 36.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21802-PA 264 GA21802-PA 1..257 20..276 731 56.9 Plus
Dpse\GA14209-PA 262 GA14209-PA 10..250 32..271 679 53.5 Plus
Dpse\GA15013-PA 286 GA15013-PA 8..252 29..271 549 44.5 Plus
Dpse\GA14683-PA 263 GA14683-PA 13..262 30..277 517 45.6 Plus
Dpse\GA18806-PA 277 GA18806-PA 32..269 39..277 386 36.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23845-PA 265 GM23845-PA 1..265 20..284 1349 95.8 Plus
Dsec\GM23846-PA 258 GM23846-PA 6..257 33..281 780 59.5 Plus
Dsec\GM26206-PA 262 GM26206-PA 11..250 33..271 675 54.6 Plus
Dsec\GM26205-PA 270 GM26205-PA 4..255 19..272 648 53.3 Plus
Dsec\GM26535-PA 253 GM26535-PA 10..253 32..278 568 48.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18652-PA 265 GD18652-PA 1..265 20..284 1345 95.8 Plus
Dsim\GD18654-PA 263 GD18654-PA 6..262 33..284 783 59.1 Plus
Dsim\GD20751-PA 264 GD20751-PA 2..263 20..279 685 52.3 Plus
Dsim\GD20753-PA 262 GD20753-PA 11..250 33..271 666 54.2 Plus
Dsim\GD20752-PA 265 GD20752-PA 5..263 20..281 649 52.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11028-PA 261 GJ11028-PA 9..257 31..278 680 52.6 Plus
Dvir\GJ11026-PA 263 GJ11026-PA 10..261 32..282 667 50.4 Plus
Dvir\GJ11027-PA 244 GJ11027-PA 9..230 31..272 582 48.6 Plus
Dvir\GJ22069-PA 248 GJ22069-PA 1..237 37..271 543 46.4 Plus
Dvir\GJ22068-PA 217 GJ22068-PA 1..216 65..279 486 45.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20708-PA 255 GK20708-PA 10..255 32..276 571 45.1 Plus
Dwil\GK20709-PA 266 GK20709-PA 6..244 45..282 541 45.2 Plus
Dwil\GK20710-PA 205 GK20710-PA 1..205 23..226 504 48.8 Plus
Dwil\GK14510-PA 217 GK14510-PA 11..165 33..187 450 56.8 Plus
Dwil\GK20706-PA 215 GK20706-PA 1..215 65..278 434 43.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25994-PA 264 GE25994-PA 1..264 20..284 1155 86.4 Plus
Dyak\GE25995-PA 254 GE25995-PA 6..253 33..279 800 60.5 Plus
Dyak\GE24722-PA 264 GE24722-PA 2..263 20..279 678 53.4 Plus
Dyak\GE24724-PA 262 GE24724-PA 11..250 33..271 659 52.9 Plus
Dyak\GE24723-PA 264 GE24723-PA 7..264 22..282 624 51.5 Plus