Clone MIP05648 Report

Search the DGRC for MIP05648

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:56
Well:48
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG4398-RA
Protein status:MIP05648.pep: gold
Sequenced Size:816

Clone Sequence Records

MIP05648.complete Sequence

816 bp assembled on 2012-10-22

GenBank Submission: BT149871.1

> MIP05648.complete
CTGCGTCGCATTGATCATAATTATATATGTACAAGTAAAAAAGCCACAAA
TATGAGTATTTTGAGACTGGTGCTGCAATTCCTGCTCTTCAGTTTGGTGC
TGGTTTCGGGAAAGTTTCTCTATCACCGGAGCTACAAATACTCCCCGGAG
CTGATAGCCGAACTGAAAGACTTTGAGAAGCTGATTCCCACGGTTACCAT
CGACGAAGTAGTCGCCGAGCATATGATTACGGATTCCGGATTCCGTAAGG
CCATTAAGTTTTTGCGCAGCTCCGATTTCAAGACGCTGCAGCAGCGCATT
GAGTCTCTGCCAGAAGTTGTGGATCTAATTAATTTCGTGCACCTCAATGA
TACGACCCAAGAAACAGTGGAGAAGTATTGGTATCGTAATAACACATATA
ACAGGCTTCGCAGGTCGGCTTATCTTAGGGAGCAGATTGTTTTGGTGCTA
CTCGAATCGAGTTCAGAGTTCACACAGTTGAGTTCGTTCACCAGTTTCGT
GCGTGAAATACTAACGCATTTGCCCCGTGATCGATTTGTGGCCCTGATCA
ATGAAAAGCGGCAGAAGAGTGCCTTGTTCGCCAAGTTCTATCAGGCACTG
AAAAGTGCAGAGTTCAAGGCGAAATCCGAAGCGGCATGGAAAACCAGCAA
TGTACAGAGCGTTGTTCAAGAACTTTCGCGACACGCAATCGATGCCCAGG
ATCTGAAAACCATAGGTTACGAAGTCATCTCTTGGGGTCCGAACACATTG
TGAGAAATTCCCTTCGAGTTAAGGCCAATAAAATGTTGCGGTGAAGCTAA
AAAAAAAAAAAAAAAA

MIP05648.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12319553..12320192 1..639 3090 99.2 Plus
chr2R 21145070 chr2R 12320310..12320469 639..798 770 98.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16432262..16432900 1..639 3195 100 Plus
2R 25286936 2R 16433018..16433179 639..800 810 100 Plus
Blast to na_te.dros performed on 2019-03-15 14:02:50 has no hits.

MIP05648.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:03:41 Download gff for MIP05648.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12319553..12320192 1..639 99 -> Plus
chr2R 12320311..12320469 640..798 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2012-10-22 16:19:52 Download gff for MIP05648.complete
Subject Subject Range Query Range Percent Splice Strand
CG4398-RA 1..702 52..753 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:16:13 Download gff for MIP05648.complete
Subject Subject Range Query Range Percent Splice Strand
CG4398-RA 1..702 52..753 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:48:16 Download gff for MIP05648.complete
Subject Subject Range Query Range Percent Splice Strand
CG4398-RA 1..702 52..753 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-10-22 16:19:51 Download gff for MIP05648.complete
Subject Subject Range Query Range Percent Splice Strand
CG4398-RA 90..887 1..798 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:16:13 Download gff for MIP05648.complete
Subject Subject Range Query Range Percent Splice Strand
CG4398-RA 19..816 1..798 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:48:16 Download gff for MIP05648.complete
Subject Subject Range Query Range Percent Splice Strand
CG4398-RA 19..816 1..798 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:03:41 Download gff for MIP05648.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16432262..16432900 1..639 100 -> Plus
2R 16433019..16433177 640..798 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:03:41 Download gff for MIP05648.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16432262..16432900 1..639 100 -> Plus
2R 16433019..16433177 640..798 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:03:41 Download gff for MIP05648.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16432262..16432900 1..639 100 -> Plus
2R 16433019..16433177 640..798 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:16:13 Download gff for MIP05648.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12319767..12320405 1..639 100 -> Plus
arm_2R 12320524..12320682 640..798 100   Plus

MIP05648.pep Sequence

Translation from 0 to 752

> MIP05648.pep
LRRIDHNYICTSKKATNMSILRLVLQFLLFSLVLVSGKFLYHRSYKYSPE
LIAELKDFEKLIPTVTIDEVVAEHMITDSGFRKAIKFLRSSDFKTLQQRI
ESLPEVVDLINFVHLNDTTQETVEKYWYRNNTYNRLRRSAYLREQIVLVL
LESSSEFTQLSSFTSFVREILTHLPRDRFVALINEKRQKSALFAKFYQAL
KSAEFKAKSEAAWKTSNVQSVVQELSRHAIDAQDLKTIGYEVISWGPNTL
*

MIP05648.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13597-PA 226 GF13597-PA 1..225 18..247 755 64.1 Plus
Dana\GF11262-PA 211 GF11262-PA 20..210 48..249 235 28.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20604-PA 235 GG20604-PA 20..235 37..250 1011 89.4 Plus
Dere\GG22265-PA 214 GG22265-PA 29..213 54..249 265 33.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21974-PA 232 GH21974-PA 11..228 47..247 537 50 Plus
Dgri\GH20644-PA 209 GH20644-PA 23..209 50..247 239 32.3 Plus
Dgri\GH22231-PA 176 GH22231-PA 1..176 61..247 216 31.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
jtb-PA 233 CG4398-PA 1..233 18..250 1163 100 Plus
CG15712-PA 214 CG15712-PA 29..213 54..249 250 32.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19677-PA 263 GI19677-PA 36..261 47..247 583 51.8 Plus
Dmoj\GI19009-PA 216 GI19009-PA 22..210 50..249 259 32.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10738-PA 241 GL10738-PA 23..240 42..247 694 63.8 Plus
Dper\GL11341-PA 215 GL11341-PA 26..215 50..250 235 29.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18157-PA 241 GA18157-PA 23..240 42..247 689 63.8 Plus
Dpse\GA13908-PA 215 GA13908-PA 26..214 50..249 230 29 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21696-PA 235 GM21696-PA 19..233 36..248 1051 94 Plus
Dsec\GM20054-PA 214 GM20054-PA 29..213 54..249 258 32.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11192-PA 235 GD11192-PA 19..233 36..248 1043 93 Plus
Dsim\GD25535-PA 214 GD25535-PA 29..213 54..249 261 33.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17158-PA 259 GJ17158-PA 41..257 47..247 553 49.3 Plus
Dvir\GJ19973-PA 212 GJ19973-PA 4..211 30..249 264 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21601-PA 167 GK21601-PA 1..126 110..249 298 47.1 Plus
Dwil\GK21600-PA 206 GK21600-PA 18..204 50..247 215 27.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11791-PA 233 GE11791-PA 1..233 18..250 1065 88.9 Plus
Dyak\GE14058-PA 214 GE14058-PA 29..212 54..248 258 33.3 Plus

MIP05648.hyp Sequence

Translation from 0 to 752

> MIP05648.hyp
LRRIDHNYICTSKKATNMSILRLVLQFLLFSLVLVSGKFLYHRSYKYSPE
LIAELKDFEKLIPTVTIDEVVAEHMITDSGFRKAIKFLRSSDFKTLQQRI
ESLPEVVDLINFVHLNDTTQETVEKYWYRNNTYNRLRRSAYLREQIVLVL
LESSSEFTQLSSFTSFVREILTHLPRDRFVALINEKRQKSALFAKFYQAL
KSAEFKAKSEAAWKTSNVQSVVQELSRHAIDAQDLKTIGYEVISWGPNTL
*

MIP05648.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG4398-PA 233 CG4398-PA 1..233 18..250 1163 100 Plus
CG15712-PA 214 CG15712-PA 29..213 54..249 250 32.1 Plus