Clone MIP05744 Report

Search the DGRC for MIP05744

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:57
Well:44
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptTengl2-RA
Protein status:MIP05744.pep: gold
Sequenced Size:1037

Clone Sequence Records

MIP05744.complete Sequence

1037 bp assembled on 2009-02-18

GenBank Submission: BT060442.1

> MIP05744.complete
AATTCACAGAGCCCATTTCATGGACCGAAAATGGCAGCTCCTGGGACTGG
GTTTCGTCCTGGGAGTGACTGCGCTCTGTGCATCCTTCGTGGGTGGAATG
TATTTTCAGCACACAGATGCCAGAAAACGCCTGCGGGAACTAATACAAAC
GGATCCCTATGCCTACTATCTCAGTCCCAAAATTTATGAAGTGTTTACTT
TCTTTGAGAGCAATAATGAAGACGATCACCGGATGAGGCAGATCATGAAG
TTTGGGTTCCCTGGCCTGGATGACTTGCGTCTGTATAGTGACTTCGTACT
ATCCTACGATCGCCGAAACCGAGTGGCCCACTGGGTGTGCGAGCACCTCC
AGGCGGACAGCATACATCCGAATCGAGGCAGACGTGGTCGCAACCCATAC
CAGCCGGATTTGAGTGTTCCCTCCAACTTCCGATCGGAACTGAGCGACTA
TCGGAGATCTGGATTCGACCGAGGACACTTGGCAGCCGCAGGAAATCACC
ATCTGCAACAGAATCACTGCGAGGATACGTTTTTCCTAACGAATATTGCC
CCACAAGTGGGCCAGGGCTTCAACCGAAGCGCGTGGAACAACTTGGAACA
ATATGTTCGAAATCTGGTCCACCGATTTGGATCCGTTTTCGTGTGTACTG
GTCCACTATATAAGCCCAATCAAAGACCGGGAGGTAAGTGGGCCGTGGAG
TACGAGATGATCGGACTGAATATGGTTGCAGTTCCGACGCACTTCTTCAA
GGTGATCATGGTGGAATCAAAACTGCACCTGGGTAAACCCTATATGGAGG
GCTATGTCCTGCCCAATGCTCCAATACCAGATGGTCTGCCACTACGATCG
TTTCTCTGCGACATCCGGGAGATTGAGCACTACGCAGGTCTCAAGTTCTT
CGATGGTTTGAGAAGGAGTGCCCTATTCGGCAGCAATTATCCAAGTGAAT
CTCGAGTTTTTCGCGAATTCAGTTAGTGGAGGGATCCCAATCGTTAAATA
TATATTTAACTTAACTGCAAAAAAAAAAAAAAAAAAA

MIP05744.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG32463-RA 1023 CG32463-RA 6..1023 1..1018 5090 100 Plus
EndoG-RA 1086 EndoG-RA 520..620 476..576 250 83.1 Plus
EndoG-RA 1086 EndoG-RA 331..389 290..348 145 83 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2238050..2238875 1018..193 3875 97.9 Minus
chr2L 23010047 chr2L 2238938..2239130 193..1 950 99.5 Minus
chr2R 21145070 chr2R 8065126..8065226 576..476 250 83.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2238302..2239129 1020..193 4140 100 Minus
2L 23513712 2L 2239192..2239384 193..1 965 100 Minus
2R 25286936 2R 12177911..12178011 576..476 250 83.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2238302..2239129 1020..193 4140 100 Minus
2L 23513712 2L 2239192..2239384 193..1 965 100 Minus
2R 25260384 2R 12179110..12179210 576..476 250 83.1 Minus
2R 25260384 2R 12179341..12179399 348..290 145 83 Minus
Blast to na_te.dros performed on 2019-03-16 00:51:55 has no hits.

MIP05744.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:52:58 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2238050..2238874 194..1018 97 <- Minus
chr2L 2238938..2239130 1..193 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:49 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
CG32463-RA 1..957 20..976 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:35:07 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
CG32463-RA 1..957 20..976 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:59:11 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
Tengl2-RA 1..957 20..976 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:15:55 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
Tengl2-RA 1..957 20..976 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-18 12:12:35 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
CG32463-RA 1..957 20..976 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:35:07 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
CG32463-RA 1..1018 1..1018 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:59:11 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
Tengl2-RA 1..1018 1..1018 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:15:55 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
Tengl2-RA 1..1018 1..1018 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:52:58 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2238304..2239128 194..1018 100 <- Minus
2L 2239192..2239384 1..193 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:52:58 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2238304..2239128 194..1018 100 <- Minus
2L 2239192..2239384 1..193 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:52:58 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2238304..2239128 194..1018 100 <- Minus
2L 2239192..2239384 1..193 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:59:11 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2239192..2239384 1..193 100   Minus
arm_2L 2238304..2239128 194..1018 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:08:28 Download gff for MIP05744.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2239192..2239384 1..193 100   Minus
2L 2238304..2239128 194..1018 100 <- Minus

MIP05744.hyp Sequence

Translation from 0 to 975

> MIP05744.hyp
IHRAHFMDRKWQLLGLGFVLGVTALCASFVGGMYFQHTDARKRLRELIQT
DPYAYYLSPKIYEVFTFFESNNEDDHRMRQIMKFGFPGLDDLRLYSDFVL
SYDRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQPDLSVPSNFRSELSDY
RRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQ
YVRNLVHRFGSVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFK
VIMVESKLHLGKPYMEGYVLPNAPIPDGLPLRSFLCDIREIEHYAGLKFF
DGLRRSALFGSNYPSESRVFREFS*

MIP05744.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
Tengl2-PA 318 CG32463-PA 1..318 7..324 1727 100 Plus
EndoG-PA 310 CG8862-PA 8..302 21..308 675 47.8 Plus
Tengl4-PA 378 CG4683-PA 125..364 70..308 545 43.2 Plus
Tengl1-PA 319 CG31682-PA 8..276 19..306 460 34.2 Plus
Tengl3-PA 337 CG31679-PA 10..305 10..312 323 26.5 Plus

MIP05744.pep Sequence

Translation from 1 to 975

> MIP05744.pep
IHRAHFMDRKWQLLGLGFVLGVTALCASFVGGMYFQHTDARKRLRELIQT
DPYAYYLSPKIYEVFTFFESNNEDDHRMRQIMKFGFPGLDDLRLYSDFVL
SYDRRNRVAHWVCEHLQADSIHPNRGRRGRNPYQPDLSVPSNFRSELSDY
RRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQ
YVRNLVHRFGSVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFK
VIMVESKLHLGKPYMEGYVLPNAPIPDGLPLRSFLCDIREIEHYAGLKFF
DGLRRSALFGSNYPSESRVFREFS*

MIP05744.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15293-PA 317 GF15293-PA 1..316 7..323 1320 75.7 Plus
Dana\GF12638-PA 310 GF12638-PA 72..306 77..312 673 54.6 Plus
Dana\GF24166-PA 323 GF24166-PA 11..306 21..308 584 40.6 Plus
Dana\GF15292-PA 313 GF15292-PA 1..287 14..319 466 33.8 Plus
Dana\GF15294-PA 338 GF15294-PA 12..302 24..309 342 28 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24541-PA 318 GG24541-PA 1..317 7..323 1633 95.3 Plus
Dere\GG22601-PA 310 GG22601-PA 72..306 77..312 684 55.7 Plus
Dere\GG17836-PA 379 GG17836-PA 136..364 81..308 540 43.9 Plus
Dere\GG24540-PA 313 GG24540-PA 8..276 19..306 484 35.2 Plus
Dere\GG24543-PA 337 GG24543-PA 10..322 10..324 325 26.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13792-PA 318 GH13792-PA 1..318 7..324 1154 67.4 Plus
Dgri\GH22148-PA 312 GH22148-PA 73..308 77..312 678 55.3 Plus
Dgri\GH24683-PA 319 GH24683-PA 6..308 14..308 632 42.8 Plus
Dgri\GH13791-PA 306 GH13791-PA 5..287 16..306 455 34.5 Plus
Dgri\GH12970-PA 306 GH12970-PA 5..287 16..306 455 34.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:48
Subject Length Description Subject Range Query Range Score Percent Strand
Tengl2-PA 318 CG32463-PA 1..318 7..324 1727 100 Plus
EndoG-PA 310 CG8862-PA 8..302 21..308 675 47.8 Plus
Tengl4-PA 378 CG4683-PA 125..364 70..308 545 43.2 Plus
Tengl1-PA 319 CG31682-PA 8..276 19..306 460 34.2 Plus
Tengl3-PA 337 CG31679-PA 10..305 10..312 323 26.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18045-PA 317 GI18045-PA 1..317 7..324 1110 67.4 Plus
Dmoj\GI19378-PA 310 GI19378-PA 10..306 18..312 691 48 Plus
Dmoj\GI21664-PA 381 GI21664-PA 139..367 81..308 577 48.3 Plus
Dmoj\GI17193-PA 312 GI17193-PA 9..288 20..306 456 33.9 Plus
Dmoj\GI18046-PA 336 GI18046-PA 2..324 4..322 376 26.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19410-PA 304 GL19410-PA 1..296 7..302 1191 75.7 Plus
Dper\GL11082-PA 304 GL11082-PA 66..300 77..312 697 55.7 Plus
Dper\GL13439-PA 314 GL13439-PA 66..278 77..290 655 56.7 Plus
Dper\GL24726-PA 229 GL24726-PA 1..225 82..312 619 53 Plus
Dper\GL25109-PA 385 GL25109-PA 142..370 81..308 549 44.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16923-PA 317 GA16923-PA 1..316 7..323 1242 74.4 Plus
Dpse\GA24605-PA 304 GA24605-PA 66..300 77..312 698 55.7 Plus
Dpse\GA23686-PA 385 GA23686-PA 142..370 81..308 550 44.8 Plus
Dpse\GA22360-PA 506 GA22360-PA 16..289 27..299 253 25.9 Plus
Dpse\GA22336-PA 308 GA22336-PA 60..292 38..309 251 26.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18249-PA 316 GM18249-PA 12..316 20..324 1501 92.1 Plus
Dsec\GM20380-PA 310 GM20380-PA 72..306 77..312 679 55.3 Plus
Dsec\GM23913-PA 378 GM23913-PA 128..364 73..308 542 43.3 Plus
Dsec\GM18248-PA 331 GM18248-PA 8..276 19..306 478 35.5 Plus
Dsec\GM18250-PA 337 GM18250-PA 10..305 10..312 325 25.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22855-PA 318 GD22855-PA 1..318 7..324 1682 98.1 Plus
Dsim\GD18726-PA 378 GD18726-PA 128..364 73..308 548 43.7 Plus
Dsim\GD22854-PA 319 GD22854-PA 8..276 19..306 479 35.2 Plus
Dsim\GD22856-PA 337 GD22856-PA 10..305 10..312 328 26.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22347-PA 318 GJ22347-PA 1..318 7..324 1163 67.4 Plus
Dvir\GJ19936-PA 310 GJ19936-PA 10..306 18..312 682 47.4 Plus
Dvir\GJ15788-PA 379 GJ15788-PA 140..368 81..308 580 48.7 Plus
Dvir\GJ22336-PA 310 GJ22336-PA 1..289 7..306 457 33.7 Plus
Dvir\GJ22358-PA 336 GJ22358-PA 9..304 12..309 373 28.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14992-PA 322 GK14992-PA 22..321 28..323 1185 73 Plus
Dwil\GK23216-PA 310 GK23216-PA 71..306 77..312 678 54.4 Plus
Dwil\GK10249-PA 366 GK10249-PA 131..359 81..310 533 44 Plus
Dwil\GK15148-PA 300 GK15148-PA 1..279 14..305 468 34.7 Plus
Dwil\GK14993-PA 314 GK14993-PA 3..313 6..315 325 27.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15178-PA 318 GE15178-PA 1..318 7..324 1637 94.3 Plus
Dyak\GE13469-PA 310 GE13469-PA 72..306 77..312 684 55.7 Plus
Dyak\GE26063-PA 379 GE26063-PA 136..364 81..308 540 43.5 Plus
Dyak\GE15173-PA 320 GE15173-PA 8..277 19..306 489 35.4 Plus
Dyak\GE15179-PA 332 GE15179-PA 10..317 10..324 320 26.3 Plus