Clone MIP05809 Report

Search the DGRC for MIP05809

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:58
Well:9
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptSt4-RA
Protein status:MIP05809.pep: gold
Sequenced Size:1094

Clone Sequence Records

MIP05809.complete Sequence

1094 bp assembled on 2011-02-22

GenBank Submission: BT126092.1

> MIP05809.complete
AGTCAACGCTGGCAACTGATCGCGCGAGCAATGGAAAATACGCCTCTCAA
GTTTCCACACGAAATTCGCGATGTGGAGGAGTCCACCAATGCTGAGCTAT
TGGATCACTTCCATGGTGAGCGAACTGGCTTCGTTCAGGTCGGATCGGAG
GGTTACTTCTTTCCGCACAAGTACAAGGACGAGGCCGAGCGGTACTACAA
CTTTGAGGCACGGCCGGATGACGTGTGGATAGCCACGGTGCCCAGATCGG
GCACCACTTGGACGCAGGAGCTCATTTGGCTGGTGGCCAATGGGCTGGAT
TTTGAGCATGCCCAGGAGCGACCACTAACCGAACGCTTTCCATTCTTTGA
ATTTCCGCTCTTTGTGCATCCCAAAATTAAGGAAGAGCTGCAGGAGGAAA
ACCGAGACTCGGCTGAAGCTCTGGAGTTCATTGAGAAGATAGCTCGACCG
GGTTACGAGGCTTTGAGCGAAATACCACGCTCGCAGCGACGGTTTATCAA
AACGCATTTCCCCTTTTCTCTAATGCCGCCTAGTGTTCTCGAAAAGAAGT
GCAAGGTGATCTATGTGGTTCGTGATCCCAAGGATGTTGCAGTTTCCTAC
TACCATTTGAACAGACTCTTCCGCACCCAAGGATACGTCGGAGATTTTGA
GCGTTACTGGCATTATTTCCAAAACGGATTAAATCCCTGGCTGCCCTATT
ACAGTCACGTTAAGGAGGCGCGGGAGCATGCCCATTTGTCCAATGTACTC
TTTCTGCGCTACGAAGACATGTTGGCTGATCTGCCAGGTGCAATCAACAG
CATAGCCAGCTTCTTAGAGTGTCCACCGAAACCCGAGGATATGGATAGGC
TACTCGATCATCTGAGCATCAGAAGCTTCCGTGAGAACAAGTCCGTAAAC
ATGCACGAAATGGCTTCCGTTGGCGTTCTCAACAAAGGAGAGGCAGGATT
CGTGCGCAGCGGAGCCAAGACAGCGTATCAGCCGCAACAGGAGTTCGTGG
AGAATCCGAAGCTTTTGAAGAGCGCCAACGAGTGGGTGGAACAGAATATT
AAATCATTCAAGACCATATGAAACAAAAAAAAAAAAAAAAAAAA

MIP05809.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9857240..9857630 1073..683 1925 99.5 Minus
chr2R 21145070 chr2R 9857680..9858011 682..351 1660 100 Minus
chr2R 21145070 chr2R 9858067..9858302 350..115 1180 100 Minus
chr2R 21145070 chr2R 9858367..9858483 117..1 585 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13969914..13970304 1073..683 1955 100 Minus
2R 25286936 2R 13970354..13970685 682..351 1660 100 Minus
2R 25286936 2R 13970741..13970976 350..115 1180 100 Minus
2R 25286936 2R 13971041..13971157 117..1 585 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13971113..13971503 1073..683 1955 100 Minus
2R 25260384 2R 13971553..13971884 682..351 1660 100 Minus
2R 25260384 2R 13971940..13972175 350..115 1180 100 Minus
2R 25260384 2R 13972240..13972356 117..1 585 100 Minus
Blast to na_te.dros performed on 2019-03-17 01:45:06 has no hits.

MIP05809.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:45:52 Download gff for MIP05809.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9857239..9857630 683..1074 99 <- Minus
chr2R 9857680..9858011 351..682 100 <- Minus
chr2R 9858067..9858301 116..350 100 <- Minus
chr2R 9858369..9858483 1..115 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-02-22 11:20:17 Download gff for MIP05809.complete
Subject Subject Range Query Range Percent Splice Strand
CG6704-RA 1..1041 31..1071 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:51:34 Download gff for MIP05809.complete
Subject Subject Range Query Range Percent Splice Strand
St4-RA 1..1041 31..1071 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:09:53 Download gff for MIP05809.complete
Subject Subject Range Query Range Percent Splice Strand
St4-RA 1..1041 31..1071 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-02-22 11:20:16 Download gff for MIP05809.complete
Subject Subject Range Query Range Percent Splice Strand
CG6704-RA 1..1073 1..1074 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:51:34 Download gff for MIP05809.complete
Subject Subject Range Query Range Percent Splice Strand
St4-RA 5..1077 1..1074 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:09:53 Download gff for MIP05809.complete
Subject Subject Range Query Range Percent Splice Strand
St4-RA 5..1077 1..1074 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:52 Download gff for MIP05809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13969913..13970304 683..1074 99 <- Minus
2R 13970354..13970685 351..682 100 <- Minus
2R 13970741..13970975 116..350 100 <- Minus
2R 13971043..13971157 1..115 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:52 Download gff for MIP05809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13969913..13970304 683..1074 99 <- Minus
2R 13970354..13970685 351..682 100 <- Minus
2R 13970741..13970975 116..350 100 <- Minus
2R 13971043..13971157 1..115 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:52 Download gff for MIP05809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13969913..13970304 683..1074 99 <- Minus
2R 13970354..13970685 351..682 100 <- Minus
2R 13970741..13970975 116..350 100 <- Minus
2R 13971043..13971157 1..115 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:51:34 Download gff for MIP05809.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9858548..9858662 1..115 100   Minus
arm_2R 9857418..9857809 683..1074 99 <- Minus
arm_2R 9857859..9858190 351..682 100 <- Minus
arm_2R 9858246..9858480 116..350 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:59:56 Download gff for MIP05809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13971112..13971503 683..1074 99 <- Minus
2R 13971553..13971884 351..682 100 <- Minus
2R 13971940..13972174 116..350 100 <- Minus
2R 13972242..13972356 1..115 100   Minus

MIP05809.hyp Sequence

Translation from 0 to 1070

> MIP05809.hyp
SQRWQLIARAMENTPLKFPHEIRDVEESTNAELLDHFHGERTGFVQVGSE
GYFFPHKYKDEAERYYNFEARPDDVWIATVPRSGTTWTQELIWLVANGLD
FEHAQERPLTERFPFFEFPLFVHPKIKEELQEENRDSAEALEFIEKIARP
GYEALSEIPRSQRRFIKTHFPFSLMPPSVLEKKCKVIYVVRDPKDVAVSY
YHLNRLFRTQGYVGDFERYWHYFQNGLNPWLPYYSHVKEAREHAHLSNVL
FLRYEDMLADLPGAINSIASFLECPPKPEDMDRLLDHLSIRSFRENKSVN
MHEMASVGVLNKGEAGFVRSGAKTAYQPQQEFVENPKLLKSANEWVEQNI
KSFKTI*

MIP05809.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
St4-PB 346 CG6704-PB 1..346 11..356 1857 100 Plus
St4-PA 346 CG6704-PA 1..346 11..356 1857 100 Plus
St1-PB 338 CG5428-PB 58..323 63..354 386 32.8 Plus
St2-PB 316 CG16733-PB 26..307 44..351 374 29 Plus
St2-PA 316 CG16733-PA 26..307 44..351 374 29 Plus

MIP05809.pep Sequence

Translation from 0 to 1070

> MIP05809.pep
SQRWQLIARAMENTPLKFPHEIRDVEESTNAELLDHFHGERTGFVQVGSE
GYFFPHKYKDEAERYYNFEARPDDVWIATVPRSGTTWTQELIWLVANGLD
FEHAQERPLTERFPFFEFPLFVHPKIKEELQEENRDSAEALEFIEKIARP
GYEALSEIPRSQRRFIKTHFPFSLMPPSVLEKKCKVIYVVRDPKDVAVSY
YHLNRLFRTQGYVGDFERYWHYFQNGLNPWLPYYSHVKEAREHAHLSNVL
FLRYEDMLADLPGAINSIASFLECPPKPEDMDRLLDHLSIRSFRENKSVN
MHEMASVGVLNKGEAGFVRSGAKTAYQPQQEFVENPKLLKSANEWVEQNI
KSFKTI*

MIP05809.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11151-PA 346 GF11151-PA 1..346 11..356 1646 86.4 Plus
Dana\GF13071-PA 338 GF13071-PA 58..323 63..354 406 33.4 Plus
Dana\GF16584-PA 316 GF16584-PA 23..284 41..316 363 29.9 Plus
Dana\GF24091-PA 733 GF24091-PA 2..193 89..304 280 33.2 Plus
Dana\GF13072-PA 272 GF13072-PA 1..255 68..348 273 29.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22455-PA 346 GG22455-PA 1..346 11..356 1764 93.6 Plus
Dere\GG22874-PA 338 GG22874-PA 58..323 63..354 380 32.4 Plus
Dere\GG15423-PA 316 GG15423-PA 23..308 41..352 364 28.3 Plus
Dere\GG22875-PA 314 GG22875-PA 27..296 58..348 282 29.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22840-PA 346 GH22840-PA 3..346 17..356 1395 73.8 Plus
Dgri\GH20666-PA 338 GH20666-PA 58..323 63..354 388 32.8 Plus
Dgri\GH19934-PA 316 GH19934-PA 23..284 41..316 368 30.6 Plus
Dgri\GH17085-PA 312 GH17085-PA 25..301 54..349 351 32.6 Plus
Dgri\GH23313-PA 310 GH23313-PA 37..299 62..353 312 29.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
St4-PB 346 CG6704-PB 1..346 11..356 1857 100 Plus
St4-PA 346 CG6704-PA 1..346 11..356 1857 100 Plus
St1-PB 338 CG5428-PB 58..323 63..354 386 32.8 Plus
St2-PB 316 CG16733-PB 26..307 44..351 374 29 Plus
St2-PA 316 CG16733-PA 26..307 44..351 374 29 Plus
St3-PB 313 CG44167-PB 21..295 48..348 302 31.2 Plus
St3-PA 331 CG44167-PA 21..295 48..348 302 31.2 Plus
St3-PC 526 CG44167-PC 21..295 48..348 302 31.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21219-PA 349 GI21219-PA 1..342 11..349 1342 71.3 Plus
Dmoj\GI19029-PA 345 GI19029-PA 58..323 63..354 388 34.5 Plus
Dmoj\GI22042-PA 316 GI22042-PA 26..281 44..321 370 31.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20087-PA 350 GL20087-PA 1..350 11..356 1507 77.7 Plus
Dper\GL16876-PA 334 GL16876-PA 58..323 63..354 384 33.1 Plus
Dper\GL13941-PA 290 GL13941-PA 11..269 24..304 361 30.4 Plus
Dper\GL16877-PA 312 GL16877-PA 27..279 58..329 268 28.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19797-PA 350 GA19797-PA 1..350 11..356 1513 78 Plus
Dpse\GA24321-PA 334 GA24321-PA 58..323 63..354 382 33.1 Plus
Dpse\GA14114-PA 316 GA14114-PA 26..308 44..352 371 28.9 Plus
Dpse\GA18876-PA 313 GA18876-PA 27..279 58..329 268 28.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20241-PA 346 GM20241-PA 1..346 11..356 1780 95.1 Plus
Dsec\GM16034-PA 338 GM16034-PA 58..323 63..354 381 33.4 Plus
Dsec\GM23787-PA 316 GM23787-PA 2..308 5..352 373 28.6 Plus
Dsec\GM16035-PA 313 GM16035-PA 27..290 58..343 312 32.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25727-PA 346 GD25727-PA 1..346 11..356 1798 96 Plus
Dsim\GD11782-PA 338 GD11782-PA 58..323 63..354 379 32.4 Plus
Dsim\GD18598-PA 316 GD18598-PA 2..308 5..352 371 28.3 Plus
Dsim\GD11783-PA 309 GD11783-PA 39..290 66..343 325 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20821-PA 349 GJ20821-PA 1..344 11..351 1390 73.3 Plus
Dvir\GJ19995-PA 345 GJ19995-PA 58..323 63..354 382 33.8 Plus
Dvir\GJ24095-PA 316 GJ24095-PA 26..308 44..352 368 29.2 Plus
Dvir\GJ11360-PA 306 GJ11360-PA 25..293 54..347 325 30.4 Plus
Dvir\GJ19997-PA 314 GJ19997-PA 26..302 53..355 302 31.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19529-PA 344 GK19529-PA 1..344 11..356 1382 73.1 Plus
Dwil\GK23067-PA 338 GK23067-PA 58..323 63..354 389 33.8 Plus
Dwil\GK22430-PA 319 GK22430-PA 11..284 24..321 362 29.5 Plus
Dwil\GK23068-PA 314 GK23068-PA 26..281 53..329 294 31.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13326-PA 346 GE13326-PA 1..346 11..356 1789 95.7 Plus
Dyak\GE14312-PA 338 GE14312-PA 58..323 63..354 382 33.4 Plus
Dyak\GE25933-PA 316 GE25933-PA 23..308 41..352 363 28.3 Plus
Dyak\GE14313-PA 317 GE14313-PA 39..295 66..348 329 33 Plus