Clone MIP05834 Report

Search the DGRC for MIP05834

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:58
Well:34
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG31710-RA
Protein status:MIP05834.pep: gold
Sequenced Size:745

Clone Sequence Records

MIP05834.complete Sequence

745 bp assembled on 2009-02-21

GenBank Submission: BT066308.1

> MIP05834.complete
CAACATCGAGCGATTCGAGGGACGGAAAATCGAAATCCGAAACGAACCGG
AGAAGATTGCCACGCGAAAAGAAAAATTGGTGCTAAGACCCCGCTAAAAA
AAAGATCCAAACAGCGCCATCGAAACCGCAAAAGAAAAGTGCACAAAACA
CAACGCATAAAAAGATAATACAAAGTTCCTATTTAAGTGCAGGCCACTTA
ACACCGTCGAATTAAATCGAGTCAAATCAGGCGGATCCAAGATGCTCACC
AGACAACCCGACTACACCATCTCCGAGCTGGGCCATCCCATCCATCAGTG
GTCGGATTCGACCGCGTGCGAGTCCCTCAAGAAGCTGGACTACACAAAGA
TGCCCAGTTCTCCGCCATCACCACATCGCCTGCTGCCACTGAGGGAAACG
TTGGACGATTGTTTCAAGCGCTTGACGATGAGGAGCAGAGAAGATTTCGA
AGAGGATCCCGTATACCAGCAGAAATTGAGAAAGAATCAGTGCAATGAAC
AGCAGCGAAGGCGCAATCAAAAATGTCGAGATAAAGCCCAGTCCGGAGCA
ACAACGACGACGACGACGACGACAACGATAGCGGCGAGCTGCGATTTAAA
CAATTTCTGAGATTAAAAAGAAGGAGGAAGAATACTTATGGGGGAAGCAA
CCTAAGCGGACTGACTAAAAGTGCTAAAATAAAACACCTTTTGCCTAGAT
CATTAAGTACATTAAATGTTAAGTAAAGAAAAAAAAAAAAAAAAA

MIP05834.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG31710.b 1019 CG31710.b 243..975 1..733 3665 100 Plus
CG31710.a 1335 CG31710.a 79..811 1..733 3665 100 Plus
CG31710-RA 855 CG31710-RA 79..811 1..733 3665 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:28:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9702096..9702435 513..174 1670 99.4 Minus
chr2L 23010047 chr2L 9701792..9702007 728..513 1080 100 Minus
chr2L 23010047 chr2L 9704601..9704776 175..1 800 98.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9703268..9703607 513..174 1700 100 Minus
2L 23513712 2L 9702959..9703179 733..513 1105 100 Minus
2L 23513712 2L 9705780..9705954 175..1 875 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9703268..9703607 513..174 1700 100 Minus
2L 23513712 2L 9702959..9703179 733..513 1105 100 Minus
2L 23513712 2L 9705780..9705954 175..1 875 100 Minus
Blast to na_te.dros performed 2019-03-15 20:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Cr1a 4470 Cr1a DMCR1A 4470bp 175..315 184..41 137 60.1 Minus

MIP05834.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:29:00 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9704601..9704776 1..175 98   Minus
chr2L 9701792..9702006 514..728 100 <- Minus
chr2L 9702096..9702433 176..513 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:21 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
CG31710-RA 1..369 242..610 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:25 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
CG31710-RA 1..369 242..610 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:53:11 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
CG31710-RA 1..369 242..610 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:36:53 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
CG31710-RA 1..369 242..610 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-21 17:15:10 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
CG31710-RA 1..600 11..610 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:25 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
CG31710-RA 1..718 11..728 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:53:11 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
CG31710-RA 1..728 1..728 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:53 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
CG31710-RA 1..728 1..728 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:29:00 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9702964..9703178 514..728 100 <- Minus
2L 9703268..9703605 176..513 100 <- Minus
2L 9705780..9705954 1..175 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:29:00 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9702964..9703178 514..728 100 <- Minus
2L 9703268..9703605 176..513 100 <- Minus
2L 9705780..9705954 1..175 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:29:00 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9702964..9703178 514..728 100 <- Minus
2L 9703268..9703605 176..513 100 <- Minus
2L 9705780..9705954 1..175 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:53:11 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9702964..9703178 514..728 100 <- Minus
arm_2L 9703268..9703605 176..513 100 <- Minus
arm_2L 9705780..9705954 1..175 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:10 Download gff for MIP05834.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9702964..9703178 514..728 100 <- Minus
2L 9703268..9703605 176..513 100 <- Minus
2L 9705780..9705954 1..175 100   Minus

MIP05834.pep Sequence

Translation from 241 to 609

> MIP05834.pep
MLTRQPDYTISELGHPIHQWSDSTACESLKKLDYTKMPSSPPSPHRLLPL
RETLDDCFKRLTMRSREDFEEDPVYQQKLRKNQCNEQQRRRNQKCRDKAQ
SGATTTTTTTTTIAASCDLNNF*

MIP05834.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21890-PA 122 GF21890-PA 1..122 1..122 443 71.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24015-PA 118 GG24015-PA 1..118 1..122 508 87.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25075-PA 127 GH25075-PA 1..119 1..93 132 37.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG31710-PC 122 CG31710-PC 1..122 1..122 656 100 Plus
CG31710-PA 122 CG31710-PA 1..122 1..122 656 100 Plus
CG31710-PD 123 CG31710-PD 1..123 1..122 644 99.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18210-PA 118 GI18210-PA 1..102 1..86 139 46.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19216-PA 546 GL19216-PA 1..94 1..100 193 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25878-PA 85 GA25878-PA 1..85 1..91 177 52.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12341-PA 119 GM12341-PA 1..119 1..122 599 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22343-PA 119 GD22343-PA 1..119 1..122 603 95.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10402-PA 119 GE10402-PA 1..119 1..122 520 90.2 Plus

MIP05834.hyp Sequence

Translation from 241 to 609

> MIP05834.hyp
MLTRQPDYTISELGHPIHQWSDSTACESLKKLDYTKMPSSPPSPHRLLPL
RETLDDCFKRLTMRSREDFEEDPVYQQKLRKNQCNEQQRRRNQKCRDKAQ
SGATTTTTTTTTIAASCDLNNF*

MIP05834.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG31710-PC 122 CG31710-PC 1..122 1..122 656 100 Plus
CG31710-PA 122 CG31710-PA 1..122 1..122 656 100 Plus
CG31710-PD 123 CG31710-PD 1..123 1..122 644 99.2 Plus