MIP05864.complete Sequence
288 bp assembled on 2009-02-24
GenBank Submission: BT070219.1
> MIP05864.complete
CTCGTGCCGAATGAAGCTACAGCTATTGGTAGTAGTACTTCTTGGTCTTT
TGGCAGTGTCCACGGCCGCACGAAAGAAAGACAAAAAAAACATTGAGATC
TGGATAAGACCGAAGCCAATGGGCTTGCCACCAGAACCGTATTAGATCAG
TTGACTCTCCTCCAATCGTATTTTCCGTAGGTTGCCACGATGGGTATTTA
AATAACGTTTGGGGCATTGTACAGATAATACCACATTATTGCTCACTAAT
AAAATGGTCACACTATTTTAAAAAAAAAAAAAAAAAAA
MIP05864.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:25:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
nc_12386.a | 260 | nc_12386.a | 1..260 | 10..269 | 1300 | 100 | Plus |
MB8.chr3L.pasa.59.a | 403 | MB8.chr3L.pasa.59.a | 19..277 | 10..272 | 1230 | 98.4 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:16:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 13290228..13290400 | 182..10 | 865 | 100 | Minus |
chr3L | 24539361 | chr3L | 13290088..13290179 | 269..178 | 445 | 98.9 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13299980..13300152 | 182..10 | 865 | 100 | Minus |
3L | 28110227 | 3L | 13299838..13299932 | 272..178 | 475 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 13293080..13293252 | 182..10 | 865 | 100 | Minus |
3L | 28103327 | 3L | 13292938..13293032 | 272..178 | 475 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 20:16:07 has no hits.
MIP05864.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:16:48 Download gff for
MIP05864.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 13290088..13290176 | 181..269 | 98 | <- | Minus |
chr3L | 13290230..13290400 | 10..180 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:04:13 Download gff for
MIP05864.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43147-RB | 1..135 | 11..145 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:56:23 Download gff for
MIP05864.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43147-RB | 1..135 | 11..145 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:04:13 Download gff for
MIP05864.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43147-RB | 1..256 | 10..269 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:56:23 Download gff for
MIP05864.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43147-RC | 1..260 | 10..269 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:48 Download gff for
MIP05864.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13299841..13299929 | 181..269 | 100 | <- | Minus |
3L | 13299982..13300152 | 10..180 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:48 Download gff for
MIP05864.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13299841..13299929 | 181..269 | 100 | <- | Minus |
3L | 13299982..13300152 | 10..180 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:48 Download gff for
MIP05864.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13299841..13299929 | 181..269 | 100 | <- | Minus |
3L | 13299982..13300152 | 10..180 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:04:13 Download gff for
MIP05864.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13292941..13293029 | 181..269 | 100 | <- | Minus |
arm_3L | 13293082..13293252 | 10..180 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:39 Download gff for
MIP05864.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13292941..13293029 | 181..269 | 100 | <- | Minus |
3L | 13293082..13293252 | 10..180 | 100 | | Minus |
MIP05864.pep Sequence
Translation from 1 to 144
> MIP05864.pep
SCRMKLQLLVVVLLGLLAVSTAARKKDKKNIEIWIRPKPMGLPPEPY*
MIP05864.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43147-PC | 44 | CG43147-PC | 1..44 | 4..47 | 223 | 100 | Plus |
CG43147-PB | 44 | CG43147-PB | 1..44 | 4..47 | 223 | 100 | Plus |
MIP05864.hyp Sequence
Translation from 10 to 144
> MIP05864.hyp
MKLQLLVVVLLGLLAVSTAARKKDKKNIEIWIRPKPMGLPPEPY*
MIP05864.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43147-PC | 44 | CG43147-PC | 1..44 | 1..44 | 223 | 100 | Plus |
CG43147-PB | 44 | CG43147-PB | 1..44 | 1..44 | 223 | 100 | Plus |