Clone MIP05864 Report

Search the DGRC for MIP05864

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:58
Well:64
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43147-RB
Protein status:MIP05864.pep: gold
Sequenced Size:288

Clone Sequence Records

MIP05864.complete Sequence

288 bp assembled on 2009-02-24

GenBank Submission: BT070219.1

> MIP05864.complete
CTCGTGCCGAATGAAGCTACAGCTATTGGTAGTAGTACTTCTTGGTCTTT
TGGCAGTGTCCACGGCCGCACGAAAGAAAGACAAAAAAAACATTGAGATC
TGGATAAGACCGAAGCCAATGGGCTTGCCACCAGAACCGTATTAGATCAG
TTGACTCTCCTCCAATCGTATTTTCCGTAGGTTGCCACGATGGGTATTTA
AATAACGTTTGGGGCATTGTACAGATAATACCACATTATTGCTCACTAAT
AAAATGGTCACACTATTTTAAAAAAAAAAAAAAAAAAA

MIP05864.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
nc_12386.a 260 nc_12386.a 1..260 10..269 1300 100 Plus
MB8.chr3L.pasa.59.a 403 MB8.chr3L.pasa.59.a 19..277 10..272 1230 98.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13290228..13290400 182..10 865 100 Minus
chr3L 24539361 chr3L 13290088..13290179 269..178 445 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13299980..13300152 182..10 865 100 Minus
3L 28110227 3L 13299838..13299932 272..178 475 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13293080..13293252 182..10 865 100 Minus
3L 28103327 3L 13292938..13293032 272..178 475 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:16:07 has no hits.

MIP05864.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:16:48 Download gff for MIP05864.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13290088..13290176 181..269 98 <- Minus
chr3L 13290230..13290400 10..180 100   Minus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:04:13 Download gff for MIP05864.complete
Subject Subject Range Query Range Percent Splice Strand
CG43147-RB 1..135 11..145 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:56:23 Download gff for MIP05864.complete
Subject Subject Range Query Range Percent Splice Strand
CG43147-RB 1..135 11..145 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:04:13 Download gff for MIP05864.complete
Subject Subject Range Query Range Percent Splice Strand
CG43147-RB 1..256 10..269 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:56:23 Download gff for MIP05864.complete
Subject Subject Range Query Range Percent Splice Strand
CG43147-RC 1..260 10..269 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:48 Download gff for MIP05864.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13299841..13299929 181..269 100 <- Minus
3L 13299982..13300152 10..180 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:48 Download gff for MIP05864.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13299841..13299929 181..269 100 <- Minus
3L 13299982..13300152 10..180 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:48 Download gff for MIP05864.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13299841..13299929 181..269 100 <- Minus
3L 13299982..13300152 10..180 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:04:13 Download gff for MIP05864.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13292941..13293029 181..269 100 <- Minus
arm_3L 13293082..13293252 10..180 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:39 Download gff for MIP05864.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13292941..13293029 181..269 100 <- Minus
3L 13293082..13293252 10..180 100   Minus

MIP05864.pep Sequence

Translation from 1 to 144

> MIP05864.pep
SCRMKLQLLVVVLLGLLAVSTAARKKDKKNIEIWIRPKPMGLPPEPY*

MIP05864.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG43147-PC 44 CG43147-PC 1..44 4..47 223 100 Plus
CG43147-PB 44 CG43147-PB 1..44 4..47 223 100 Plus

MIP05864.hyp Sequence

Translation from 10 to 144

> MIP05864.hyp
MKLQLLVVVLLGLLAVSTAARKKDKKNIEIWIRPKPMGLPPEPY*

MIP05864.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG43147-PC 44 CG43147-PC 1..44 1..44 223 100 Plus
CG43147-PB 44 CG43147-PB 1..44 1..44 223 100 Plus