Clone MIP05908 Report

Search the DGRC for MIP05908

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:59
Well:8
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptInr-a-RC
Protein status:MIP05908.pep: gold
Sequenced Size:812

Clone Sequence Records

MIP05908.complete Sequence

812 bp assembled on 2009-02-20

GenBank Submission: BT064645.1

> MIP05908.complete
AATACATCGCAGTTGTTACGTGAGAGTTTTCAAAAGCTAATTTTTATATA
GTAGCAGTGCTTTTGTGAAATTTTTTCCTCGCAAAAGTGTCTGGCAGTGA
TTGTACAAATGTATTAGCTTAAAAAGTCGAAACATAGCAACTGCGACTAC
TTCAAACCAAATAACTTGATCAATATCCGGATCAAGATCTGGAATACAGA
GTCCACAATGGAGCAGCTATTTCAGAATTACCGCGACGATGAGCGAAGGA
TCGGCGAGGAGTATCTGTCAAGTCTCCAGGACCTCAACTGCAACAGCAAG
CCATTGATCAATATGCTCACGATGCTTGCCGAGGAGAACATCAACTACGC
CCACATCATAGTTAAAGTGGTGGAATATTACATCAGCCAGGTTAACAAAA
CAAAAGCGTATTTACTTAAAAACAAAGACACTCCAGCTTACACACAGCTA
ATAGACGGTCGACACTAAAAGTGATTCTCCATATCGAAATTGTGATAGAA
TGTGCAGTTTATTGATTGCGGTTGCCCTTTGATTGCAGAGAAACCCAACG
AAGGCCACACATATGCGTTTCTAAGACTCGGTTCTTTCAGTTGGGTTTTT
CTGCAAACTCTTGGGCACAAATGGTAGATAGGTTCCTAATAATCTTAGTA
TATATCTCATAATTTGGGTTATAAACCGTGACTGATTTTAATCATCTACA
AAGGTAAGAAGTTTAACCAACCTGCTCCTCGTTTCTTATTTCTTTCTACT
TTGGATCCCAGAGTTTAAAGCTAAGGAATAACAAACAACCTTTAAAAAAA
AAAAAAAAAAAA

MIP05908.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Pcf11-RC 905 Pcf11-RC 43..842 1..800 4000 100 Plus
Pcf11-RB 2750 Pcf11-RB 26..417 1..392 1960 100 Plus
Pcf11.a 6068 Pcf11.a 24..415 1..392 1960 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10756972..10757640 793..125 3345 100 Minus
chr2R 21145070 chr2R 10758246..10758371 126..1 630 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14869639..14870314 800..125 3380 100 Minus
2R 25286936 2R 14870920..14871045 126..1 630 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14870838..14871513 800..125 3380 100 Minus
2R 25260384 2R 14872119..14872244 126..1 630 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:08:34 has no hits.

MIP05908.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:09:20 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10756972..10757638 127..793 99 <- Minus
chr2R 10758246..10758371 1..126 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:04 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
Pcf11-RA 1..185 208..392 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:03 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
Pcf11-RC 1..261 208..468 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:47:51 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
Inr-a-RC 1..261 208..468 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:42 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
Inr-a-RC 1..261 208..468 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-20 22:03:56 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
Pcf11-RA 24..415 1..392 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:03 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
Pcf11-RC 26..818 1..793 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:47:51 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
Inr-a-RC 27..819 1..793 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:42 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
Inr-a-RC 27..819 1..793 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:09:20 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14869646..14870312 127..793 100 <- Minus
2R 14870920..14871045 1..126 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:09:20 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14869646..14870312 127..793 100 <- Minus
2R 14870920..14871045 1..126 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:09:20 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14869646..14870312 127..793 100 <- Minus
2R 14870920..14871045 1..126 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:47:51 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10757151..10757817 127..793 100 <- Minus
arm_2R 10758425..10758550 1..126 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:46 Download gff for MIP05908.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14870845..14871511 127..793 100 <- Minus
2R 14872119..14872244 1..126 100   Minus

MIP05908.pep Sequence

Translation from 207 to 467

> MIP05908.pep
MEQLFQNYRDDERRIGEEYLSSLQDLNCNSKPLINMLTMLAEENINYAHI
IVKVVEYYISQVNKTKAYLLKNKDTPAYTQLIDGRH*

MIP05908.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12082-PA 1971 GF12082-PA 1..62 1..62 314 93.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22388-PA 1946 GG22388-PA 1..62 1..62 330 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22985-PA 2093 GH22985-PA 1..62 1..62 263 80.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:07
Subject Length Description Subject Range Query Range Score Percent Strand
Pcf11-PC 86 CG10228-PC 1..86 1..86 445 100 Plus
Pcf11-PB 573 CG10228-PB 1..62 1..62 317 100 Plus
Pcf11-PH 1839 CG10228-PH 1..62 1..62 317 100 Plus
Pcf11-PE 1839 CG10228-PE 1..62 1..62 317 100 Plus
Pcf11-PF 1850 CG10228-PF 1..62 1..62 317 100 Plus
Pcf11-PG 1945 CG10228-PG 1..62 1..62 317 100 Plus
Pcf11-PD 1953 CG10228-PD 1..62 1..62 317 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18953-PA 2052 GI18953-PA 1..62 1..62 283 82.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17525-PA 1973 GL17525-PA 1..62 1..62 316 95.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24192-PB 584 GA24192-PB 1..62 1..62 322 93.5 Plus
Dpse\GA24192-PA 1971 GA24192-PA 1..62 1..62 312 93.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20171-PA 1933 GM20171-PA 1..62 1..62 320 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25648-PA 963 GD25648-PA 1..62 1..62 322 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21559-PA 2061 GJ21559-PA 1..62 1..62 276 82.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22121-PA 2009 GK22121-PA 1..62 1..62 306 91.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12277-PA 1949 GE12277-PA 1..62 1..62 330 100 Plus
Dyak\GE11305-PA 57 GE11305-PA 1..52 1..52 246 88.5 Plus

MIP05908.hyp Sequence

Translation from 207 to 467

> MIP05908.hyp
MEQLFQNYRDDERRIGEEYLSSLQDLNCNSKPLINMLTMLAEENINYAHI
IVKVVEYYISQVNKTKAYLLKNKDTPAYTQLIDGRH*

MIP05908.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
Inr-a-PC 86 CG10228-PC 1..86 1..86 445 100 Plus
Inr-a-PB 573 CG10228-PB 1..62 1..62 317 100 Plus
Inr-a-PH 1839 CG10228-PH 1..62 1..62 317 100 Plus
Inr-a-PE 1839 CG10228-PE 1..62 1..62 317 100 Plus
Inr-a-PF 1850 CG10228-PF 1..62 1..62 317 100 Plus