Clone MIP05946 Report

Search the DGRC for MIP05946

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:59
Well:46
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43134-RA
Protein status:MIP05946.pep: gold
Sequenced Size:354

Clone Sequence Records

MIP05946.complete Sequence

354 bp assembled on 2009-02-24

GenBank Submission: BT072945.1

> MIP05946.complete
AAAGTAGTCGATACATTCGAAACGTACCAAAATGTTCAACAAAACGATTT
TCGTAGCCCTCCTTGTCTGCGCCTGCTACCTTGGCACAAGTGAGGCTCGC
CCAGGACTTACCGATGTGGCCTCTGGACCAGTTGGATCAGCCGTGCCATT
GGTAACTGGAGCTCTTGGTGGCCTAACTGGAGGAGTAGCTGGCTCTGCTC
TGCCTCAGCTGACTGGTTCTCTTGGCCAGTCAGGACCTTTGGGATTGGCC
CAAGGACCACTTTCAGGACTTACCGGTTAATCCCTAGAACACTTCGGAAG
CTCCTAGGCAACTTTTTCTCAAACAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

MIP05946.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
DMG5-MB6.chrX.8.004.a 533 DMG5-MB6.chrX.8.004.a 114..440 2..328 1620 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4140506..4140759 71..324 1240 99.2 Plus
chrX 22417052 chrX 4140371..4140440 2..71 350 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4247448..4247705 71..328 1275 99.6 Plus
X 23542271 X 4247313..4247382 2..71 350 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4255546..4255803 71..328 1275 99.6 Plus
X 23527363 X 4255411..4255480 2..71 350 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:18:06 has no hits.

MIP05946.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:18:57 Download gff for MIP05946.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4140370..4140440 1..71 98 -> Plus
chrX 4140507..4140759 72..324 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:37:16 Download gff for MIP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG43134-RB 1..249 32..280 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:17 Download gff for MIP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG43134-RB 1..249 32..280 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:37:16 Download gff for MIP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG43134-RB 1..323 2..324 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:17 Download gff for MIP05946.complete
Subject Subject Range Query Range Percent Splice Strand
CG43134-RB 1..323 2..324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:57 Download gff for MIP05946.complete
Subject Subject Range Query Range Percent Splice Strand
X 4247312..4247382 1..71 98 -> Plus
X 4247449..4247701 72..324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:57 Download gff for MIP05946.complete
Subject Subject Range Query Range Percent Splice Strand
X 4247312..4247382 1..71 98 -> Plus
X 4247449..4247701 72..324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:57 Download gff for MIP05946.complete
Subject Subject Range Query Range Percent Splice Strand
X 4247312..4247382 1..71 98 -> Plus
X 4247449..4247701 72..324 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:37:16 Download gff for MIP05946.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4141345..4141415 1..71 98 -> Plus
arm_X 4141482..4141734 72..324 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:27 Download gff for MIP05946.complete
Subject Subject Range Query Range Percent Splice Strand
X 4255547..4255799 72..324 99   Plus
X 4255410..4255480 1..71 98 -> Plus

MIP05946.pep Sequence

Translation from 31 to 279

> MIP05946.pep
MFNKTIFVALLVCACYLGTSEARPGLTDVASGPVGSAVPLVTGALGGLTG
GVAGSALPQLTGSLGQSGPLGLAQGPLSGLTG*

MIP05946.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18698-PA 81 GG18698-PA 1..67 1..67 265 80.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG43134-PA 82 CG43134-PA 1..82 1..82 415 100 Plus
CG43134-PB 82 CG43134-PB 1..82 1..82 415 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12334-PA 82 GM12334-PA 1..82 1..82 295 91.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16678-PA 82 GD16678-PA 1..82 1..82 306 92.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16336-PA 80 GE16336-PA 1..80 1..82 189 68.7 Plus

MIP05946.hyp Sequence

Translation from 31 to 279

> MIP05946.hyp
MFNKTIFVALLVCACYLGTSEARPGLTDVASGPVGSAVPLVTGALGGLTG
GVAGSALPQLTGSLGQSGPLGLAQGPLSGLTG*

MIP05946.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG43134-PA 82 CG43134-PA 1..82 1..82 415 100 Plus
CG43134-PB 82 CG43134-PB 1..82 1..82 415 100 Plus