MIP05946.complete Sequence
354 bp assembled on 2009-02-24
GenBank Submission: BT072945.1
> MIP05946.complete
AAAGTAGTCGATACATTCGAAACGTACCAAAATGTTCAACAAAACGATTT
TCGTAGCCCTCCTTGTCTGCGCCTGCTACCTTGGCACAAGTGAGGCTCGC
CCAGGACTTACCGATGTGGCCTCTGGACCAGTTGGATCAGCCGTGCCATT
GGTAACTGGAGCTCTTGGTGGCCTAACTGGAGGAGTAGCTGGCTCTGCTC
TGCCTCAGCTGACTGGTTCTCTTGGCCAGTCAGGACCTTTGGGATTGGCC
CAAGGACCACTTTCAGGACTTACCGGTTAATCCCTAGAACACTTCGGAAG
CTCCTAGGCAACTTTTTCTCAAACAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA
MIP05946.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:25:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
DMG5-MB6.chrX.8.004.a | 533 | DMG5-MB6.chrX.8.004.a | 114..440 | 2..328 | 1620 | 99.6 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:18:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 4140506..4140759 | 71..324 | 1240 | 99.2 | Plus |
chrX | 22417052 | chrX | 4140371..4140440 | 2..71 | 350 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 4247448..4247705 | 71..328 | 1275 | 99.6 | Plus |
X | 23542271 | X | 4247313..4247382 | 2..71 | 350 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 4255546..4255803 | 71..328 | 1275 | 99.6 | Plus |
X | 23527363 | X | 4255411..4255480 | 2..71 | 350 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 23:18:06 has no hits.
MIP05946.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:18:57 Download gff for
MIP05946.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 4140370..4140440 | 1..71 | 98 | -> | Plus |
chrX | 4140507..4140759 | 72..324 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:37:16 Download gff for
MIP05946.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43134-RB | 1..249 | 32..280 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:17 Download gff for
MIP05946.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43134-RB | 1..249 | 32..280 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:37:16 Download gff for
MIP05946.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43134-RB | 1..323 | 2..324 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:17 Download gff for
MIP05946.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43134-RB | 1..323 | 2..324 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:57 Download gff for
MIP05946.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 4247312..4247382 | 1..71 | 98 | -> | Plus |
X | 4247449..4247701 | 72..324 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:57 Download gff for
MIP05946.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 4247312..4247382 | 1..71 | 98 | -> | Plus |
X | 4247449..4247701 | 72..324 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:57 Download gff for
MIP05946.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 4247312..4247382 | 1..71 | 98 | -> | Plus |
X | 4247449..4247701 | 72..324 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:37:16 Download gff for
MIP05946.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 4141345..4141415 | 1..71 | 98 | -> | Plus |
arm_X | 4141482..4141734 | 72..324 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:27 Download gff for
MIP05946.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 4255547..4255799 | 72..324 | 99 | | Plus |
X | 4255410..4255480 | 1..71 | 98 | -> | Plus |
MIP05946.pep Sequence
Translation from 31 to 279
> MIP05946.pep
MFNKTIFVALLVCACYLGTSEARPGLTDVASGPVGSAVPLVTGALGGLTG
GVAGSALPQLTGSLGQSGPLGLAQGPLSGLTG*
MIP05946.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:02:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG18698-PA | 81 | GG18698-PA | 1..67 | 1..67 | 265 | 80.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43134-PA | 82 | CG43134-PA | 1..82 | 1..82 | 415 | 100 | Plus |
CG43134-PB | 82 | CG43134-PB | 1..82 | 1..82 | 415 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:03:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM12334-PA | 82 | GM12334-PA | 1..82 | 1..82 | 295 | 91.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:03:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD16678-PA | 82 | GD16678-PA | 1..82 | 1..82 | 306 | 92.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:03:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE16336-PA | 80 | GE16336-PA | 1..80 | 1..82 | 189 | 68.7 | Plus |
MIP05946.hyp Sequence
Translation from 31 to 279
> MIP05946.hyp
MFNKTIFVALLVCACYLGTSEARPGLTDVASGPVGSAVPLVTGALGGLTG
GVAGSALPQLTGSLGQSGPLGLAQGPLSGLTG*
MIP05946.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:47:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43134-PA | 82 | CG43134-PA | 1..82 | 1..82 | 415 | 100 | Plus |
CG43134-PB | 82 | CG43134-PB | 1..82 | 1..82 | 415 | 100 | Plus |