Clone MIP05953 Report

Search the DGRC for MIP05953

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:59
Well:53
Vector:pOT2|pOTB7_DraIII
Protein status:MIP05953.pep: Imported from assembly
Sequenced Size:419

Clone Sequence Records

MIP05953.complete Sequence

419 bp assembled on 2010-04-12

GenBank Submission: BT124740.1

> MIP05953.complete
CCAGCCTCAAGTGGTTAGCTATTCTACAACTCTTAATTATTTTCGGTGCT
CTTGGGCACGCCGAAGTTGATGAAATTACCGATGTCGTAAAGGAGAAGCT
TTATGAGGCTATCTCCAAAACTGGATCTACGATCAAATCCGGATCGGCAA
GCTTACAGAGTCTTGATGATGCCGTGCGTAACGTTATAAAAATGAAAAAG
GGCGCGGCTAAGTCGCTCTTGGATCTAGTAAGCAATCGTATCTTAAAACC
TGAAAAGGACGCACCCGCTTCCCTCTCATCATGTGGTGAAGGGGAATTAG
TTTGTGAAATCAAAGGGGTACTGGCCGCAGAATCCACACAGCAACCAAAC
ACCATAACTTAATGTAGTGTGTATTGCAAGGAAATAAAGAGGAAAGCATC
TAAAAAAAAAAAAAAAAAA

MIP05953.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp26Ad-RA 601 Sfp26Ad-RA 54..456 1..403 2015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5941831..5942184 401..48 1770 100 Minus
chr2L 23010047 chr2L 5942254..5942301 48..1 240 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5942778..5943133 403..48 1780 100 Minus
2L 23513712 2L 5943203..5943250 48..1 240 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5942778..5943133 403..48 1780 100 Minus
2L 23513712 2L 5943203..5943250 48..1 240 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:43:58 has no hits.

MIP05953.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:44:48 Download gff for MIP05953.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5941831..5942183 49..401 100 <- Minus
chr2L 5942254..5942301 1..48 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:55:00 Download gff for MIP05953.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ad-RA 5..366 1..362 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:23:18 Download gff for MIP05953.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ad-RA 5..366 1..362 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:25:38 Download gff for MIP05953.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ad-RA 5..366 1..362 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:55:00 Download gff for MIP05953.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ad-RA 14..413 1..400 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:23:18 Download gff for MIP05953.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ad-RA 14..414 1..401 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:25:38 Download gff for MIP05953.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ad-RA 35..435 1..401 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:44:48 Download gff for MIP05953.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5942780..5943132 49..401 100 <- Minus
2L 5943203..5943250 1..48 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:44:48 Download gff for MIP05953.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5942780..5943132 49..401 100 <- Minus
2L 5943203..5943250 1..48 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:44:48 Download gff for MIP05953.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5942780..5943132 49..401 100 <- Minus
2L 5943203..5943250 1..48 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:23:18 Download gff for MIP05953.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5942780..5943132 49..401 100 <- Minus
arm_2L 5943203..5943250 1..48 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:46:36 Download gff for MIP05953.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5942780..5943132 49..401 100 <- Minus
2L 5943203..5943250 1..48 100   Minus

MIP05953.pep Sequence

Translation from 2 to 361

> MIP05953.pep
SLKWLAILQLLIIFGALGHAEVDEITDVVKEKLYEAISKTGSTIKSGSAS
LQSLDDAVRNVIKMKKGAAKSLLDLVSNRILKPEKDAPASLSSCGEGELV
CEIKGVLAAESTQQPNTIT*

MIP05953.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp26Ad-PB 121 CG42603-PB 3..121 1..119 579 100 Plus
Sfp26Ad-PA 121 CG42603-PA 3..121 1..119 579 100 Plus

MIP05953.hyp Sequence

Translation from 2 to 361

> MIP05953.hyp
SLKWLAILQLLIIFGALGHAEVDEITDVVKEKLYEAISKTGSTIKSGSAS
LQSLDDAVRNVIKMKKGAAKSLLDLVSNRILKPEKDAPASLSSCGEGELV
CEIKGVLAAESTQQPNTIT*

MIP05953.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp26Ad-PB 121 CG42603-PB 3..121 1..119 579 100 Plus
Sfp26Ad-PA 121 CG42603-PA 3..121 1..119 579 100 Plus