Clone MIP05958 Report

Search the DGRC for MIP05958

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:59
Well:58
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptSkadu-RA
Protein status:MIP05958.pep: gold
Sequenced Size:691

Clone Sequence Records

MIP05958.complete Sequence

691 bp assembled on 2009-02-20

GenBank Submission: BT064648.1

> MIP05958.complete
AAAAAAAACAATTCAACACGAAAATATATATATTTAATAAGACCAAATGG
AATCAGCCGTACGAAAGCGCAGAGTTCCCTTTCTCCAGGACAATAGACAT
TCCGATAAACGGACATGCAACTTGTCAACAATATCACCTCGCAGCACTCT
AGTTCAAACAGTAAAGAAACCCGTCAAGAAGTTCTCTTCGGATTTAGCCA
ATCTTCCACCGGTTCCCGCAATCGATGCTTTTGAGCGAGGCTACCAAGTG
GAATCGATATTGGACATGGTACAAAACATCCACAAGGAGCAATTCCTCTA
CATAAAGTTTACGAATCTCATTGAACCCGAGTTGGTTCCTTTGGAACTGG
CCTTACAGCATGTTCCACACCTGCTTTCTGATTTCTACAAGGAATACGTC
CAGGCCTGGCAGAAAATGGAACAACAGAAGTATGATGAATCTCCTTAAAA
TTGAAGAGAGAAATTAAACACAATGAAGTATGAGAAGTGCGAAACTGCCT
CACATTTATGACGCATCCTTTTCTGCAGTCTCGCGTCGAGTTTTAAATAA
TTTTATGCCTATTTGGCTCGTACAGCTCGCAAAATTTCGCACCTCAGCCA
TCAAAAGTTGGGGCGGACGTGCGTGCCAGAAGTTTTTGCCATCCGCAAAT
AAAGGATACAGAAAATGTTTAAAAAAAAAAAAAAAAAAAAA

MIP05958.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG42448-RA 817 CG42448-RA 113..785 1..673 3365 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15546398..15546973 95..670 2835 99.5 Plus
chr2L 23010047 chr2L 15546249..15546342 1..94 470 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15547668..15548246 95..673 2895 100 Plus
2L 23513712 2L 15547519..15547612 1..94 470 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15547668..15548246 95..673 2895 100 Plus
2L 23513712 2L 15547519..15547612 1..94 470 100 Plus
Blast to na_te.dros performed 2019-03-15 23:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 6746..6784 1..39 114 76.9 Plus

MIP05958.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:18:46 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15546249..15546342 1..94 100 -> Plus
chr2L 15546398..15546973 95..670 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:12 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
CG42448-RA 1..402 47..448 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:36:40 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
CG42448-RA 1..402 47..448 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:36:46 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
Skadu-RA 1..402 47..448 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:27:48 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
Skadu-RA 1..402 47..448 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-20 22:04:11 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
CG42448-RA 1..504 47..550 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:36:39 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
CG42448-RA 1..670 1..670 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:36:46 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
Skadu-RA 1..670 1..670 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:27:48 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
Skadu-RA 1..670 1..670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:46 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15547519..15547612 1..94 100 -> Plus
2L 15547668..15548243 95..670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:46 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15547519..15547612 1..94 100 -> Plus
2L 15547668..15548243 95..670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:46 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15547519..15547612 1..94 100 -> Plus
2L 15547668..15548243 95..670 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:36:46 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15547519..15547612 1..94 100 -> Plus
arm_2L 15547668..15548243 95..670 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:17 Download gff for MIP05958.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15547668..15548243 95..670 100   Plus
2L 15547519..15547612 1..94 100 -> Plus

MIP05958.hyp Sequence

Translation from 46 to 447

> MIP05958.hyp
MESAVRKRRVPFLQDNRHSDKRTCNLSTISPRSTLVQTVKKPVKKFSSDL
ANLPPVPAIDAFERGYQVESILDMVQNIHKEQFLYIKFTNLIEPELVPLE
LALQHVPHLLSDFYKEYVQAWQKMEQQKYDESP*

MIP05958.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
Skadu-PA 133 CG42448-PA 1..133 1..133 689 100 Plus

MIP05958.pep Sequence

Translation from 46 to 447

> MIP05958.pep
MESAVRKRRVPFLQDNRHSDKRTCNLSTISPRSTLVQTVKKPVKKFSSDL
ANLPPVPAIDAFERGYQVESILDMVQNIHKEQFLYIKFTNLIEPELVPLE
LALQHVPHLLSDFYKEYVQAWQKMEQQKYDESP*

MIP05958.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
Skadu-PA 133 CG42448-PA 1..133 1..133 689 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16095-PA 128 GM16095-PA 1..128 1..128 608 90.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24011-PA 129 GD24011-PA 1..127 1..127 616 92.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21034-PA 135 GE21034-PA 1..133 1..133 550 79.7 Plus