MIP05958.complete Sequence
691 bp assembled on 2009-02-20
GenBank Submission: BT064648.1
> MIP05958.complete
AAAAAAAACAATTCAACACGAAAATATATATATTTAATAAGACCAAATGG
AATCAGCCGTACGAAAGCGCAGAGTTCCCTTTCTCCAGGACAATAGACAT
TCCGATAAACGGACATGCAACTTGTCAACAATATCACCTCGCAGCACTCT
AGTTCAAACAGTAAAGAAACCCGTCAAGAAGTTCTCTTCGGATTTAGCCA
ATCTTCCACCGGTTCCCGCAATCGATGCTTTTGAGCGAGGCTACCAAGTG
GAATCGATATTGGACATGGTACAAAACATCCACAAGGAGCAATTCCTCTA
CATAAAGTTTACGAATCTCATTGAACCCGAGTTGGTTCCTTTGGAACTGG
CCTTACAGCATGTTCCACACCTGCTTTCTGATTTCTACAAGGAATACGTC
CAGGCCTGGCAGAAAATGGAACAACAGAAGTATGATGAATCTCCTTAAAA
TTGAAGAGAGAAATTAAACACAATGAAGTATGAGAAGTGCGAAACTGCCT
CACATTTATGACGCATCCTTTTCTGCAGTCTCGCGTCGAGTTTTAAATAA
TTTTATGCCTATTTGGCTCGTACAGCTCGCAAAATTTCGCACCTCAGCCA
TCAAAAGTTGGGGCGGACGTGCGTGCCAGAAGTTTTTGCCATCCGCAAAT
AAAGGATACAGAAAATGTTTAAAAAAAAAAAAAAAAAAAAA
MIP05958.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:24:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42448-RA | 817 | CG42448-RA | 113..785 | 1..673 | 3365 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:17:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 15546398..15546973 | 95..670 | 2835 | 99.5 | Plus |
chr2L | 23010047 | chr2L | 15546249..15546342 | 1..94 | 470 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:17:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 15547668..15548246 | 95..673 | 2895 | 100 | Plus |
2L | 23513712 | 2L | 15547519..15547612 | 1..94 | 470 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 15547668..15548246 | 95..673 | 2895 | 100 | Plus |
2L | 23513712 | 2L | 15547519..15547612 | 1..94 | 470 | 100 | Plus |
Blast to na_te.dros performed 2019-03-15 23:17:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tabor | 7345 | Tabor TABOR 7345bp | 6746..6784 | 1..39 | 114 | 76.9 | Plus |
MIP05958.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:18:46 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 15546249..15546342 | 1..94 | 100 | -> | Plus |
chr2L | 15546398..15546973 | 95..670 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:12 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42448-RA | 1..402 | 47..448 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:36:40 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42448-RA | 1..402 | 47..448 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:36:46 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Skadu-RA | 1..402 | 47..448 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:27:48 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Skadu-RA | 1..402 | 47..448 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-20 22:04:11 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42448-RA | 1..504 | 47..550 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:36:39 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42448-RA | 1..670 | 1..670 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:36:46 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Skadu-RA | 1..670 | 1..670 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:27:48 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Skadu-RA | 1..670 | 1..670 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:46 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 15547519..15547612 | 1..94 | 100 | -> | Plus |
2L | 15547668..15548243 | 95..670 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:46 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 15547519..15547612 | 1..94 | 100 | -> | Plus |
2L | 15547668..15548243 | 95..670 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:46 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 15547519..15547612 | 1..94 | 100 | -> | Plus |
2L | 15547668..15548243 | 95..670 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:36:46 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 15547519..15547612 | 1..94 | 100 | -> | Plus |
arm_2L | 15547668..15548243 | 95..670 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:17 Download gff for
MIP05958.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 15547668..15548243 | 95..670 | 100 | | Plus |
2L | 15547519..15547612 | 1..94 | 100 | -> | Plus |
MIP05958.hyp Sequence
Translation from 46 to 447
> MIP05958.hyp
MESAVRKRRVPFLQDNRHSDKRTCNLSTISPRSTLVQTVKKPVKKFSSDL
ANLPPVPAIDAFERGYQVESILDMVQNIHKEQFLYIKFTNLIEPELVPLE
LALQHVPHLLSDFYKEYVQAWQKMEQQKYDESP*
MIP05958.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Skadu-PA | 133 | CG42448-PA | 1..133 | 1..133 | 689 | 100 | Plus |
MIP05958.pep Sequence
Translation from 46 to 447
> MIP05958.pep
MESAVRKRRVPFLQDNRHSDKRTCNLSTISPRSTLVQTVKKPVKKFSSDL
ANLPPVPAIDAFERGYQVESILDMVQNIHKEQFLYIKFTNLIEPELVPLE
LALQHVPHLLSDFYKEYVQAWQKMEQQKYDESP*
MIP05958.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Skadu-PA | 133 | CG42448-PA | 1..133 | 1..133 | 689 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:06:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM16095-PA | 128 | GM16095-PA | 1..128 | 1..128 | 608 | 90.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:06:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24011-PA | 129 | GD24011-PA | 1..127 | 1..127 | 616 | 92.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:06:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21034-PA | 135 | GE21034-PA | 1..133 | 1..133 | 550 | 79.7 | Plus |