MIP05965.complete Sequence
715 bp assembled on 2009-04-03
GenBank Submission: BT081405.1
> MIP05965.complete
AGAAACACAATTCTCTAAACCCTCATTCATATTCTACTATTTTTTATTCC
CAGTCCCAGCTGTATAAATAGTCAGCTCAAAATTACAAAATACCCCTTTA
CAGTTTAGTCAAGATGCGTCCACAGATTGCAATGTTACTATTGATAACTG
CTTGGAAAAGTAGCCTATCAGATCCGATAGGTCCCCGTTCCTATGAAAAC
TATTCAGTGTATAAGGTTTTCATTAAAACTCGGTCGGATCAACAGGTTAT
CGATGGACTGCTGAAGGACACAGACAATTATAACTTGTGGCATCGTGGCT
TAAATGTAGTTCACATAATGGTGAGCCCTGTGGAAAAGGATTCTTTCCTA
GCTGTAATGCAAAAGGAAAATATTGTTGTGGAAGTACTTATAAAAAATGT
TCAGACACTTATTGATAGATACTGACGTGTCGTTGTTTTTATAAAGTTTA
ATAATTTTCCCATTTAAGCAGTGATCTTGAACTATGCAATATCATGAACA
AAACGTAAAGCTAAAATGTGAATGATACAGCCTAATGGTATGCTTCACAT
CTTATATGATCTGGTATTAGATTTGAAAAACTTCCAAAAATATATTTTGT
ATACCTTTGTGCTCTAACATTATTTAACAATTATTGTCGAATGTGGTCAT
AAAGAATGTTATTTATTTGAATGCTCACAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA
MIP05965.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:28:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MB8.chr2L.pasa.808.a | 682 | MB8.chr2L.pasa.808.a | 1..680 | 1..680 | 3400 | 100 | Plus |
MB8.chr2L.pasa.809.a | 627 | MB8.chr2L.pasa.809.a | 1..298 | 109..406 | 1490 | 100 | Plus |
TepII.b | 4896 | TepII.b | 4563..4840 | 278..1 | 1390 | 100 | Minus |
MB8.chr2L.pasa.809.a | 627 | MB8.chr2L.pasa.809.a | 356..627 | 407..678 | 1360 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:33:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 7692125..7692402 | 1..278 | 1360 | 99.3 | Plus |
chr2L | 23010047 | chr2L | 7692645..7692916 | 407..678 | 1360 | 100 | Plus |
chr2L | 23010047 | chr2L | 7692460..7692587 | 279..406 | 640 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:33:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7693030..7693307 | 1..278 | 1390 | 100 | Plus |
2L | 23513712 | 2L | 7693550..7693823 | 407..680 | 1370 | 100 | Plus |
2L | 23513712 | 2L | 7693365..7693492 | 279..406 | 640 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7693030..7693307 | 1..278 | 1390 | 100 | Plus |
2L | 23513712 | 2L | 7693550..7693823 | 407..680 | 1370 | 100 | Plus |
2L | 23513712 | 2L | 7693365..7693492 | 279..406 | 640 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 02:33:01 has no hits.
MIP05965.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:34:11 Download gff for
MIP05965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 7692125..7692402 | 1..278 | 99 | -> | Plus |
chr2L | 7692460..7692587 | 279..406 | 100 | -> | Plus |
chr2L | 7692645..7692916 | 407..678 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:28 Download gff for
MIP05965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43235-RA | 1..312 | 114..425 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:14:47 Download gff for
MIP05965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43235-RA | 1..312 | 114..425 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:28 Download gff for
MIP05965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43235-RA | 1..678 | 1..678 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:14:47 Download gff for
MIP05965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43235-RA | 1..678 | 1..678 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:34:11 Download gff for
MIP05965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7693030..7693307 | 1..278 | 100 | -> | Plus |
2L | 7693365..7693492 | 279..406 | 100 | -> | Plus |
2L | 7693550..7693821 | 407..678 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:34:11 Download gff for
MIP05965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7693030..7693307 | 1..278 | 100 | -> | Plus |
2L | 7693365..7693492 | 279..406 | 100 | -> | Plus |
2L | 7693550..7693821 | 407..678 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:34:11 Download gff for
MIP05965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7693030..7693307 | 1..278 | 100 | -> | Plus |
2L | 7693365..7693492 | 279..406 | 100 | -> | Plus |
2L | 7693550..7693821 | 407..678 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:28 Download gff for
MIP05965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 7693030..7693307 | 1..278 | 100 | -> | Plus |
arm_2L | 7693365..7693492 | 279..406 | 100 | -> | Plus |
arm_2L | 7693550..7693821 | 407..678 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:04 Download gff for
MIP05965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7693030..7693307 | 1..278 | 100 | -> | Plus |
2L | 7693365..7693492 | 279..406 | 100 | -> | Plus |
2L | 7693550..7693821 | 407..678 | 100 | | Plus |
MIP05965.pep Sequence
Translation from 113 to 424
> MIP05965.pep
MRPQIAMLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLL
KDTDNYNLWHRGLNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLI
DRY*
MIP05965.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:56:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14014-PA | 428 | GF14014-PA | 29..103 | 27..101 | 166 | 40 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:56:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23518-PA | 429 | GG23518-PA | 29..103 | 27..101 | 172 | 44 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43235-PA | 103 | CG43235-PA | 1..103 | 1..103 | 526 | 100 | Plus |
CG7025-PA | 429 | CG7025-PA | 8..103 | 5..101 | 166 | 36.1 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:56:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL18860-PA | 429 | GL18860-PA | 30..104 | 27..101 | 157 | 38.7 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:56:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA20041-PA | 429 | GA20041-PA | 9..104 | 5..101 | 171 | 38.1 | Plus |
Dpse\GA25898-PA | 112 | GA25898-PA | 40..111 | 26..97 | 140 | 44.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:56:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM13458-PA | 429 | GM13458-PA | 8..103 | 5..101 | 151 | 33 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:56:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD22481-PA | 429 | GD22481-PA | 8..103 | 5..101 | 167 | 36.1 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:56:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK23953-PA | 418 | GK23953-PA | 25..100 | 27..101 | 144 | 36.8 | Plus |
Dwil\GK23952-PA | 418 | GK23952-PA | 25..100 | 27..101 | 143 | 38.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:56:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18344-PA | 429 | GE18344-PA | 29..103 | 27..101 | 167 | 41.3 | Plus |
MIP05965.hyp Sequence
Translation from 113 to 424
> MIP05965.hyp
MRPQIAMLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLL
KDTDNYNLWHRGLNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLI
DRY*
MIP05965.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43235-PA | 103 | CG43235-PA | 1..103 | 1..103 | 526 | 100 | Plus |
CG7025-PA | 429 | CG7025-PA | 8..103 | 5..101 | 166 | 36.1 | Plus |