Clone MIP05965 Report

Search the DGRC for MIP05965

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:59
Well:65
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43235-RA
Protein status:MIP05965.pep: gold
Sequenced Size:715

Clone Sequence Records

MIP05965.complete Sequence

715 bp assembled on 2009-04-03

GenBank Submission: BT081405.1

> MIP05965.complete
AGAAACACAATTCTCTAAACCCTCATTCATATTCTACTATTTTTTATTCC
CAGTCCCAGCTGTATAAATAGTCAGCTCAAAATTACAAAATACCCCTTTA
CAGTTTAGTCAAGATGCGTCCACAGATTGCAATGTTACTATTGATAACTG
CTTGGAAAAGTAGCCTATCAGATCCGATAGGTCCCCGTTCCTATGAAAAC
TATTCAGTGTATAAGGTTTTCATTAAAACTCGGTCGGATCAACAGGTTAT
CGATGGACTGCTGAAGGACACAGACAATTATAACTTGTGGCATCGTGGCT
TAAATGTAGTTCACATAATGGTGAGCCCTGTGGAAAAGGATTCTTTCCTA
GCTGTAATGCAAAAGGAAAATATTGTTGTGGAAGTACTTATAAAAAATGT
TCAGACACTTATTGATAGATACTGACGTGTCGTTGTTTTTATAAAGTTTA
ATAATTTTCCCATTTAAGCAGTGATCTTGAACTATGCAATATCATGAACA
AAACGTAAAGCTAAAATGTGAATGATACAGCCTAATGGTATGCTTCACAT
CTTATATGATCTGGTATTAGATTTGAAAAACTTCCAAAAATATATTTTGT
ATACCTTTGTGCTCTAACATTATTTAACAATTATTGTCGAATGTGGTCAT
AAAGAATGTTATTTATTTGAATGCTCACAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

MIP05965.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
MB8.chr2L.pasa.808.a 682 MB8.chr2L.pasa.808.a 1..680 1..680 3400 100 Plus
MB8.chr2L.pasa.809.a 627 MB8.chr2L.pasa.809.a 1..298 109..406 1490 100 Plus
TepII.b 4896 TepII.b 4563..4840 278..1 1390 100 Minus
MB8.chr2L.pasa.809.a 627 MB8.chr2L.pasa.809.a 356..627 407..678 1360 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7692125..7692402 1..278 1360 99.3 Plus
chr2L 23010047 chr2L 7692645..7692916 407..678 1360 100 Plus
chr2L 23010047 chr2L 7692460..7692587 279..406 640 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7693030..7693307 1..278 1390 100 Plus
2L 23513712 2L 7693550..7693823 407..680 1370 100 Plus
2L 23513712 2L 7693365..7693492 279..406 640 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7693030..7693307 1..278 1390 100 Plus
2L 23513712 2L 7693550..7693823 407..680 1370 100 Plus
2L 23513712 2L 7693365..7693492 279..406 640 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:33:01 has no hits.

MIP05965.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:34:11 Download gff for MIP05965.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7692125..7692402 1..278 99 -> Plus
chr2L 7692460..7692587 279..406 100 -> Plus
chr2L 7692645..7692916 407..678 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:28 Download gff for MIP05965.complete
Subject Subject Range Query Range Percent Splice Strand
CG43235-RA 1..312 114..425 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:14:47 Download gff for MIP05965.complete
Subject Subject Range Query Range Percent Splice Strand
CG43235-RA 1..312 114..425 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:28 Download gff for MIP05965.complete
Subject Subject Range Query Range Percent Splice Strand
CG43235-RA 1..678 1..678 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:14:47 Download gff for MIP05965.complete
Subject Subject Range Query Range Percent Splice Strand
CG43235-RA 1..678 1..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:34:11 Download gff for MIP05965.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7693030..7693307 1..278 100 -> Plus
2L 7693365..7693492 279..406 100 -> Plus
2L 7693550..7693821 407..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:34:11 Download gff for MIP05965.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7693030..7693307 1..278 100 -> Plus
2L 7693365..7693492 279..406 100 -> Plus
2L 7693550..7693821 407..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:34:11 Download gff for MIP05965.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7693030..7693307 1..278 100 -> Plus
2L 7693365..7693492 279..406 100 -> Plus
2L 7693550..7693821 407..678 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:28 Download gff for MIP05965.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7693030..7693307 1..278 100 -> Plus
arm_2L 7693365..7693492 279..406 100 -> Plus
arm_2L 7693550..7693821 407..678 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:04 Download gff for MIP05965.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7693030..7693307 1..278 100 -> Plus
2L 7693365..7693492 279..406 100 -> Plus
2L 7693550..7693821 407..678 100   Plus

MIP05965.pep Sequence

Translation from 113 to 424

> MIP05965.pep
MRPQIAMLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLL
KDTDNYNLWHRGLNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLI
DRY*

MIP05965.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14014-PA 428 GF14014-PA 29..103 27..101 166 40 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23518-PA 429 GG23518-PA 29..103 27..101 172 44 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG43235-PA 103 CG43235-PA 1..103 1..103 526 100 Plus
CG7025-PA 429 CG7025-PA 8..103 5..101 166 36.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18860-PA 429 GL18860-PA 30..104 27..101 157 38.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20041-PA 429 GA20041-PA 9..104 5..101 171 38.1 Plus
Dpse\GA25898-PA 112 GA25898-PA 40..111 26..97 140 44.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13458-PA 429 GM13458-PA 8..103 5..101 151 33 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22481-PA 429 GD22481-PA 8..103 5..101 167 36.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23953-PA 418 GK23953-PA 25..100 27..101 144 36.8 Plus
Dwil\GK23952-PA 418 GK23952-PA 25..100 27..101 143 38.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18344-PA 429 GE18344-PA 29..103 27..101 167 41.3 Plus

MIP05965.hyp Sequence

Translation from 113 to 424

> MIP05965.hyp
MRPQIAMLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLL
KDTDNYNLWHRGLNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLI
DRY*

MIP05965.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG43235-PA 103 CG43235-PA 1..103 1..103 526 100 Plus
CG7025-PA 429 CG7025-PA 8..103 5..101 166 36.1 Plus