MIP05983.complete Sequence
538 bp assembled on 2009-02-24
GenBank Submission: BT070221.1
> MIP05983.complete
GTCTGAACTAAAAACGGGAACAACATGTGCAAGTGTCTGGTCGGAAACGT
TGCCTGCTGCTGCTGCAGTTGTGCAATTAGTGTGCTTGTTTCAATCATCA
GTGGATTGCTGGTGGTCGGCATTGTGGTCGGATTGGCCGTCTACTTTCTT
GTCTACTACGAACCGGAGGATGAGGTTACCAAGTTCACCAATAAATTAGC
CGAAAGTGTACAGTCGGGATATGGCAAAATTAAGGATGTCATAAGCAAAT
TAAATTGAGCATGATTAGTACACAGCGAAAAATGTTCCACGCTTTGCATA
ATTCCATTCATCCAAATTAATTGCCACCAATTTACAGAAACGAACACCGC
TGGAGCCTTTTAGAAGAGGATAATTGTTAAACTGTTTAATTATCAGTACA
AATAAATATTACAACACCTTCTAAATAATATTGTGAATCTCCATCTAATG
CAAAAGATGTTTTAACGCAAAAGATTTTATAAATAAATATTTATGATGTT
CAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
MIP05983.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:25:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42394-RB | 588 | CG42394-RB | 66..569 | 1..504 | 2520 | 100 | Plus |
CG42394-RA | 648 | CG42394-RA | 66..328 | 1..263 | 1315 | 100 | Plus |
CG42394.a | 695 | CG42394.a | 99..361 | 1..263 | 1315 | 100 | Plus |
CG42394-RA | 648 | CG42394-RA | 388..629 | 263..504 | 1210 | 100 | Plus |
CG42394.a | 695 | CG42394.a | 421..662 | 263..504 | 1210 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:12:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 6677086..6677326 | 263..503 | 1190 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 6676822..6677026 | 59..263 | 1025 | 100 | Plus |
chr3R | 27901430 | chr3R | 6675499..6675557 | 1..59 | 295 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:12:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 10851548..10851789 | 263..504 | 1210 | 100 | Plus |
3R | 32079331 | 3R | 10851284..10851488 | 59..263 | 1025 | 100 | Plus |
3R | 32079331 | 3R | 10849961..10850019 | 1..59 | 295 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 10592379..10592620 | 263..504 | 1210 | 100 | Plus |
3R | 31820162 | 3R | 10592115..10592319 | 59..263 | 1025 | 100 | Plus |
3R | 31820162 | 3R | 10590792..10590850 | 1..59 | 295 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-17 00:12:43 has no hits.
MIP05983.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:13:27 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 6675499..6675557 | 1..59 | 100 | -> | Plus |
chr3R | 6676823..6677026 | 60..263 | 100 | -> | Plus |
chr3R | 6677087..6677295 | 264..472 | 99 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:36 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42394-RA | 1..234 | 25..258 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:50 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42394-RC | 1..234 | 25..258 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:31:47 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42394-RA | 1..234 | 25..258 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:14:15 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42394-RD | 1..234 | 25..258 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:50 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42394-RB | 1..503 | 1..503 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:31:47 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42394-RB | 1..503 | 1..503 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:14:15 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42394-RB | 1..503 | 1..503 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:27 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10849961..10850019 | 1..59 | 100 | -> | Plus |
3R | 10851285..10851488 | 60..263 | 100 | -> | Plus |
3R | 10851549..10851788 | 264..503 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:27 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10849961..10850019 | 1..59 | 100 | -> | Plus |
3R | 10851285..10851488 | 60..263 | 100 | -> | Plus |
3R | 10851549..10851788 | 264..503 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:27 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10849961..10850019 | 1..59 | 100 | -> | Plus |
3R | 10851285..10851488 | 60..263 | 100 | -> | Plus |
3R | 10851549..10851788 | 264..503 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:31:47 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 6675683..6675741 | 1..59 | 100 | -> | Plus |
arm_3R | 6677007..6677210 | 60..263 | 100 | -> | Plus |
arm_3R | 6677271..6677510 | 264..503 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:41 Download gff for
MIP05983.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10592116..10592319 | 60..263 | 100 | -> | Plus |
3R | 10592380..10592619 | 264..503 | 100 | | Plus |
3R | 10590792..10590850 | 1..59 | 100 | -> | Plus |
MIP05983.pep Sequence
Translation from 24 to 257
> MIP05983.pep
MCKCLVGNVACCCCSCAISVLVSIISGLLVVGIVVGLAVYFLVYYEPEDE
VTKFTNKLAESVQSGYGKIKDVISKLN*
MIP05983.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:01:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF17908-PA | 75 | GF17908-PA | 1..75 | 1..75 | 225 | 74.7 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:01:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG17748-PA | 75 | GG17748-PA | 1..75 | 1..75 | 288 | 70.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42394-PC | 77 | CG42394-PC | 1..77 | 1..77 | 398 | 100 | Plus |
CG42394-PB | 77 | CG42394-PB | 1..77 | 1..77 | 398 | 100 | Plus |
CG42394-PD | 77 | CG42394-PD | 1..77 | 1..77 | 398 | 100 | Plus |
CG42394-PA | 77 | CG42394-PA | 1..77 | 1..77 | 398 | 100 | Plus |
mex1-PC | 83 | CG7936-PC | 5..81 | 1..75 | 149 | 36.4 | Plus |
mex1-PA | 83 | CG7936-PA | 5..81 | 1..75 | 149 | 36.4 | Plus |
mex1-PB | 83 | CG7936-PB | 5..81 | 1..75 | 147 | 36.4 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:01:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI12225-PA | 82 | GI12225-PA | 5..80 | 1..75 | 132 | 40.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:02:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23904-PA | 75 | GM23904-PA | 1..75 | 1..75 | 294 | 73.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:02:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18716-PA | 75 | GD18716-PA | 1..75 | 1..75 | 294 | 73.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:02:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE26055-PA | 75 | GE26055-PA | 1..75 | 1..75 | 295 | 73.3 | Plus |
MIP05983.hyp Sequence
Translation from 24 to 257
> MIP05983.hyp
MCKCLVGNVACCCCSCAISVLVSIISGLLVVGIVVGLAVYFLVYYEPEDE
VTKFTNKLAESVQSGYGKIKDVISKLN*
MIP05983.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42394-PC | 77 | CG42394-PC | 1..77 | 1..77 | 398 | 100 | Plus |
CG42394-PB | 77 | CG42394-PB | 1..77 | 1..77 | 398 | 100 | Plus |
CG42394-PD | 77 | CG42394-PD | 1..77 | 1..77 | 398 | 100 | Plus |
CG42394-PA | 77 | CG42394-PA | 1..77 | 1..77 | 398 | 100 | Plus |
mex1-PC | 83 | CG7936-PC | 5..81 | 1..75 | 149 | 36.4 | Plus |