Clone MIP05983 Report

Search the DGRC for MIP05983

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:59
Well:83
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42394-RA
Protein status:MIP05983.pep: gold
Sequenced Size:538

Clone Sequence Records

MIP05983.complete Sequence

538 bp assembled on 2009-02-24

GenBank Submission: BT070221.1

> MIP05983.complete
GTCTGAACTAAAAACGGGAACAACATGTGCAAGTGTCTGGTCGGAAACGT
TGCCTGCTGCTGCTGCAGTTGTGCAATTAGTGTGCTTGTTTCAATCATCA
GTGGATTGCTGGTGGTCGGCATTGTGGTCGGATTGGCCGTCTACTTTCTT
GTCTACTACGAACCGGAGGATGAGGTTACCAAGTTCACCAATAAATTAGC
CGAAAGTGTACAGTCGGGATATGGCAAAATTAAGGATGTCATAAGCAAAT
TAAATTGAGCATGATTAGTACACAGCGAAAAATGTTCCACGCTTTGCATA
ATTCCATTCATCCAAATTAATTGCCACCAATTTACAGAAACGAACACCGC
TGGAGCCTTTTAGAAGAGGATAATTGTTAAACTGTTTAATTATCAGTACA
AATAAATATTACAACACCTTCTAAATAATATTGTGAATCTCCATCTAATG
CAAAAGATGTTTTAACGCAAAAGATTTTATAAATAAATATTTATGATGTT
CAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP05983.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG42394-RB 588 CG42394-RB 66..569 1..504 2520 100 Plus
CG42394-RA 648 CG42394-RA 66..328 1..263 1315 100 Plus
CG42394.a 695 CG42394.a 99..361 1..263 1315 100 Plus
CG42394-RA 648 CG42394-RA 388..629 263..504 1210 100 Plus
CG42394.a 695 CG42394.a 421..662 263..504 1210 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6677086..6677326 263..503 1190 99.6 Plus
chr3R 27901430 chr3R 6676822..6677026 59..263 1025 100 Plus
chr3R 27901430 chr3R 6675499..6675557 1..59 295 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10851548..10851789 263..504 1210 100 Plus
3R 32079331 3R 10851284..10851488 59..263 1025 100 Plus
3R 32079331 3R 10849961..10850019 1..59 295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10592379..10592620 263..504 1210 100 Plus
3R 31820162 3R 10592115..10592319 59..263 1025 100 Plus
3R 31820162 3R 10590792..10590850 1..59 295 100 Plus
Blast to na_te.dros performed on 2019-03-17 00:12:43 has no hits.

MIP05983.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:13:27 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6675499..6675557 1..59 100 -> Plus
chr3R 6676823..6677026 60..263 100 -> Plus
chr3R 6677087..6677295 264..472 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:36 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
CG42394-RA 1..234 25..258 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:50 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
CG42394-RC 1..234 25..258 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:31:47 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
CG42394-RA 1..234 25..258 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:14:15 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
CG42394-RD 1..234 25..258 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:50 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
CG42394-RB 1..503 1..503 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:31:47 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
CG42394-RB 1..503 1..503 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:14:15 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
CG42394-RB 1..503 1..503 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:27 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10849961..10850019 1..59 100 -> Plus
3R 10851285..10851488 60..263 100 -> Plus
3R 10851549..10851788 264..503 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:27 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10849961..10850019 1..59 100 -> Plus
3R 10851285..10851488 60..263 100 -> Plus
3R 10851549..10851788 264..503 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:27 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10849961..10850019 1..59 100 -> Plus
3R 10851285..10851488 60..263 100 -> Plus
3R 10851549..10851788 264..503 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:31:47 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6675683..6675741 1..59 100 -> Plus
arm_3R 6677007..6677210 60..263 100 -> Plus
arm_3R 6677271..6677510 264..503 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:41 Download gff for MIP05983.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10592116..10592319 60..263 100 -> Plus
3R 10592380..10592619 264..503 100   Plus
3R 10590792..10590850 1..59 100 -> Plus

MIP05983.pep Sequence

Translation from 24 to 257

> MIP05983.pep
MCKCLVGNVACCCCSCAISVLVSIISGLLVVGIVVGLAVYFLVYYEPEDE
VTKFTNKLAESVQSGYGKIKDVISKLN*

MIP05983.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17908-PA 75 GF17908-PA 1..75 1..75 225 74.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17748-PA 75 GG17748-PA 1..75 1..75 288 70.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG42394-PC 77 CG42394-PC 1..77 1..77 398 100 Plus
CG42394-PB 77 CG42394-PB 1..77 1..77 398 100 Plus
CG42394-PD 77 CG42394-PD 1..77 1..77 398 100 Plus
CG42394-PA 77 CG42394-PA 1..77 1..77 398 100 Plus
mex1-PC 83 CG7936-PC 5..81 1..75 149 36.4 Plus
mex1-PA 83 CG7936-PA 5..81 1..75 149 36.4 Plus
mex1-PB 83 CG7936-PB 5..81 1..75 147 36.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12225-PA 82 GI12225-PA 5..80 1..75 132 40.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23904-PA 75 GM23904-PA 1..75 1..75 294 73.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18716-PA 75 GD18716-PA 1..75 1..75 294 73.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26055-PA 75 GE26055-PA 1..75 1..75 295 73.3 Plus

MIP05983.hyp Sequence

Translation from 24 to 257

> MIP05983.hyp
MCKCLVGNVACCCCSCAISVLVSIISGLLVVGIVVGLAVYFLVYYEPEDE
VTKFTNKLAESVQSGYGKIKDVISKLN*

MIP05983.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42394-PC 77 CG42394-PC 1..77 1..77 398 100 Plus
CG42394-PB 77 CG42394-PB 1..77 1..77 398 100 Plus
CG42394-PD 77 CG42394-PD 1..77 1..77 398 100 Plus
CG42394-PA 77 CG42394-PA 1..77 1..77 398 100 Plus
mex1-PC 83 CG7936-PC 5..81 1..75 149 36.4 Plus