MIP05985.complete Sequence
529 bp assembled on 2009-02-24
GenBank Submission: BT072946.1
> MIP05985.complete
AATTAACTGTTACTTCAAGATGAAAATTACCATTGCAATTCTAGGACTTT
TTCTGGCACTTATTTGCAGCCTGGAATCGCCAACCGCAGCGTGCGATATC
CAAGCAGTTTATAATCAAACCTTAAAGTTCTGCGAAAACAACTTCTTTCT
GAACATATTCTTGTGCACCGGCTTGTCTTACGGTGTCGGCAACGAGAAAT
TTGTTCAGACGCTCCAGTCGCAAAGGAAGATCTTGTGTGCAATACCATTT
TTTGCTGAAATTTGCAAAACCTGCGATTTTTCGACGATTGTCTCAAATGA
TCAGAATGCTACGATTTCAAGCGGAAATTCAACTGCAGACGCCACCCGAA
CTTTGAAGCTTGCCGATCTGACGCGTTAAACAAACAGCTGTACTGGAAAA
CAACAGAGCCGAAGGATATTGAATTTATAAGATTGTACTAAAAACCCTCT
TCTTTTTGCACTTTGGCATGCCAGCTGTTAAATAAACTATCCAAGCATTG
CAAAAAAAAAAAAAAAAAAAAAAAAAAAA
MIP05985.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:25:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MB8.chrX.pasa.101.a | 554 | MB8.chrX.pasa.101.a | 22..524 | 1..503 | 2515 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:14:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 7304904..7305227 | 178..501 | 1605 | 99.7 | Plus |
chrX | 22417052 | chrX | 7304747..7304838 | 91..182 | 460 | 100 | Plus |
chrX | 22417052 | chrX | 7304599..7304689 | 1..91 | 455 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7412973..7413298 | 178..503 | 1615 | 99.7 | Plus |
X | 23542271 | X | 7412816..7412907 | 91..182 | 460 | 100 | Plus |
X | 23542271 | X | 7412668..7412758 | 1..91 | 455 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 7421071..7421396 | 178..503 | 1615 | 99.6 | Plus |
X | 23527363 | X | 7420914..7421005 | 91..182 | 460 | 100 | Plus |
X | 23527363 | X | 7420766..7420856 | 1..91 | 455 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 07:14:01 has no hits.
MIP05985.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:14:59 Download gff for
MIP05985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 7304599..7304689 | 1..91 | 100 | -> | Plus |
chrX | 7304748..7304837 | 92..181 | 100 | -> | Plus |
chrX | 7304908..7305227 | 182..501 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:40 Download gff for
MIP05985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42704-RA | 1..360 | 20..379 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:26 Download gff for
MIP05985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42704-RA | 1..360 | 20..379 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:29:30 Download gff for
MIP05985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42704-RA | 1..360 | 20..379 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:40 Download gff for
MIP05985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42704-RA | 1..501 | 1..501 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:26 Download gff for
MIP05985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42704-RA | 1..501 | 1..501 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:29:30 Download gff for
MIP05985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42704-RA | 1..501 | 1..501 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:59 Download gff for
MIP05985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7412668..7412758 | 1..91 | 100 | -> | Plus |
X | 7412817..7412906 | 92..181 | 100 | -> | Plus |
X | 7412977..7413296 | 182..501 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:59 Download gff for
MIP05985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7412668..7412758 | 1..91 | 100 | -> | Plus |
X | 7412817..7412906 | 92..181 | 100 | -> | Plus |
X | 7412977..7413296 | 182..501 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:59 Download gff for
MIP05985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7412668..7412758 | 1..91 | 100 | -> | Plus |
X | 7412817..7412906 | 92..181 | 100 | -> | Plus |
X | 7412977..7413296 | 182..501 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:26 Download gff for
MIP05985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 7306850..7306939 | 92..181 | 100 | -> | Plus |
arm_X | 7306701..7306791 | 1..91 | 100 | -> | Plus |
arm_X | 7307010..7307329 | 182..501 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:28 Download gff for
MIP05985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7421075..7421394 | 182..501 | 100 | | Plus |
X | 7420766..7420856 | 1..91 | 100 | -> | Plus |
X | 7420915..7421004 | 92..181 | 100 | -> | Plus |
MIP05985.hyp Sequence
Translation from 0 to 378
> MIP05985.hyp
INCYFKMKITIAILGLFLALICSLESPTAACDIQAVYNQTLKFCENNFFL
NIFLCTGLSYGVGNEKFVQTLQSQRKILCAIPFFAEICKTCDFSTIVSND
QNATISSGNSTADATRTLKLADLTR*
MIP05985.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:28:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42704-PA | 119 | CG42704-PA | 1..119 | 7..125 | 609 | 100 | Plus |
MIP05985.pep Sequence
Translation from 1 to 378
> MIP05985.pep
INCYFKMKITIAILGLFLALICSLESPTAACDIQAVYNQTLKFCENNFFL
NIFLCTGLSYGVGNEKFVQTLQSQRKILCAIPFFAEICKTCDFSTIVSND
QNATISSGNSTADATRTLKLADLTR*
MIP05985.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42704-PA | 119 | CG42704-PA | 1..119 | 7..125 | 609 | 100 | Plus |