Clone MIP05985 Report

Search the DGRC for MIP05985

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:59
Well:85
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42704-RA
Protein status:MIP05985.pep: gold
Sequenced Size:529

Clone Sequence Records

MIP05985.complete Sequence

529 bp assembled on 2009-02-24

GenBank Submission: BT072946.1

> MIP05985.complete
AATTAACTGTTACTTCAAGATGAAAATTACCATTGCAATTCTAGGACTTT
TTCTGGCACTTATTTGCAGCCTGGAATCGCCAACCGCAGCGTGCGATATC
CAAGCAGTTTATAATCAAACCTTAAAGTTCTGCGAAAACAACTTCTTTCT
GAACATATTCTTGTGCACCGGCTTGTCTTACGGTGTCGGCAACGAGAAAT
TTGTTCAGACGCTCCAGTCGCAAAGGAAGATCTTGTGTGCAATACCATTT
TTTGCTGAAATTTGCAAAACCTGCGATTTTTCGACGATTGTCTCAAATGA
TCAGAATGCTACGATTTCAAGCGGAAATTCAACTGCAGACGCCACCCGAA
CTTTGAAGCTTGCCGATCTGACGCGTTAAACAAACAGCTGTACTGGAAAA
CAACAGAGCCGAAGGATATTGAATTTATAAGATTGTACTAAAAACCCTCT
TCTTTTTGCACTTTGGCATGCCAGCTGTTAAATAAACTATCCAAGCATTG
CAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP05985.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
MB8.chrX.pasa.101.a 554 MB8.chrX.pasa.101.a 22..524 1..503 2515 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7304904..7305227 178..501 1605 99.7 Plus
chrX 22417052 chrX 7304747..7304838 91..182 460 100 Plus
chrX 22417052 chrX 7304599..7304689 1..91 455 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7412973..7413298 178..503 1615 99.7 Plus
X 23542271 X 7412816..7412907 91..182 460 100 Plus
X 23542271 X 7412668..7412758 1..91 455 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7421071..7421396 178..503 1615 99.6 Plus
X 23527363 X 7420914..7421005 91..182 460 100 Plus
X 23527363 X 7420766..7420856 1..91 455 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:14:01 has no hits.

MIP05985.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:14:59 Download gff for MIP05985.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7304599..7304689 1..91 100 -> Plus
chrX 7304748..7304837 92..181 100 -> Plus
chrX 7304908..7305227 182..501 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:40 Download gff for MIP05985.complete
Subject Subject Range Query Range Percent Splice Strand
CG42704-RA 1..360 20..379 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:26 Download gff for MIP05985.complete
Subject Subject Range Query Range Percent Splice Strand
CG42704-RA 1..360 20..379 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:29:30 Download gff for MIP05985.complete
Subject Subject Range Query Range Percent Splice Strand
CG42704-RA 1..360 20..379 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:40 Download gff for MIP05985.complete
Subject Subject Range Query Range Percent Splice Strand
CG42704-RA 1..501 1..501 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:26 Download gff for MIP05985.complete
Subject Subject Range Query Range Percent Splice Strand
CG42704-RA 1..501 1..501 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:29:30 Download gff for MIP05985.complete
Subject Subject Range Query Range Percent Splice Strand
CG42704-RA 1..501 1..501 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:59 Download gff for MIP05985.complete
Subject Subject Range Query Range Percent Splice Strand
X 7412668..7412758 1..91 100 -> Plus
X 7412817..7412906 92..181 100 -> Plus
X 7412977..7413296 182..501 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:59 Download gff for MIP05985.complete
Subject Subject Range Query Range Percent Splice Strand
X 7412668..7412758 1..91 100 -> Plus
X 7412817..7412906 92..181 100 -> Plus
X 7412977..7413296 182..501 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:59 Download gff for MIP05985.complete
Subject Subject Range Query Range Percent Splice Strand
X 7412668..7412758 1..91 100 -> Plus
X 7412817..7412906 92..181 100 -> Plus
X 7412977..7413296 182..501 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:26 Download gff for MIP05985.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7306850..7306939 92..181 100 -> Plus
arm_X 7306701..7306791 1..91 100 -> Plus
arm_X 7307010..7307329 182..501 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:28 Download gff for MIP05985.complete
Subject Subject Range Query Range Percent Splice Strand
X 7421075..7421394 182..501 100   Plus
X 7420766..7420856 1..91 100 -> Plus
X 7420915..7421004 92..181 100 -> Plus

MIP05985.hyp Sequence

Translation from 0 to 378

> MIP05985.hyp
INCYFKMKITIAILGLFLALICSLESPTAACDIQAVYNQTLKFCENNFFL
NIFLCTGLSYGVGNEKFVQTLQSQRKILCAIPFFAEICKTCDFSTIVSND
QNATISSGNSTADATRTLKLADLTR*

MIP05985.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG42704-PA 119 CG42704-PA 1..119 7..125 609 100 Plus

MIP05985.pep Sequence

Translation from 1 to 378

> MIP05985.pep
INCYFKMKITIAILGLFLALICSLESPTAACDIQAVYNQTLKFCENNFFL
NIFLCTGLSYGVGNEKFVQTLQSQRKILCAIPFFAEICKTCDFSTIVSND
QNATISSGNSTADATRTLKLADLTR*

MIP05985.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG42704-PA 119 CG42704-PA 1..119 7..125 609 100 Plus