Clone MIP06012 Report

Search the DGRC for MIP06012

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:60
Well:12
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG31345-RA
Protein status:MIP06012.pep: gold
Sequenced Size:994

Clone Sequence Records

MIP06012.complete Sequence

994 bp assembled on 2009-02-21

GenBank Submission: BT066314.1

> MIP06012.complete
CGAACGCTCCGCACACGCGACACGTGCGTGGAAAACTCCGTATTGCTGCG
ACATTGTGTATTGTGAAAAGTTGAAACTGTTGAAACTGGAATAAAATAAT
AATAGACACTGAGTGTCAGCAGCTGCCGGGAAAGATGCATCGCGAAAACG
CCTACAGCAAGGAGGCCGAGCTGAAGAATCTGGCCAAACGCGAGTTGGCC
AACGGGTTGGACAAGGATCCAATTTACAAATTGCGCCTGCAGTGCTTCAG
TCGCGGTGCCACCGGCATCTTGGGCCTGTCCAGATCATTCCGGGTGATGG
ACGACGATGGCAGCAAATCTCTCAGTCCCGAGGAGTTCAAAAAAGGAGTC
ACGGATATCGGCCTGGACCTGACTGATTCCGAAATCGATGAAATGTTCTC
CAGATTCGACACAGATGGAAGTGGCAATATTAATATGACAGAATTCCTAG
TAAAGCTGCGTCCTCCTATGAATAATTCGCGTATCAGTATCATCGAAAAG
GCCTTCGATAAGATGGATGCCAATGGCGATGGCCAAATTACTGTCACCGA
TTTGAAGAATGTATATTCGGTGCGCGATCATCCGAAATACTTAAGTGGCG
AGATGACGGAAAACCAGATATTCACGCAGTTCCTGAAAAACTTCGAGGTG
GGTGCTCCAAATCCGGATGGCATCGTAACCAGGGAGGAATTTATCAACTA
CTATGCCACGATCAGCGCCTCGATCGATAACGACGCTTATTTTGATCTTA
TGATGAGACAAGCCTACAAACTCTAGATTGTGTTCCACTTAGAGATTTAA
TATCTAACGTCCATTTGCCGTCTATTAAGCTTTATATGTTGATTGAATTG
CGCACATGTAATAACAACTAAAAGCCAAGCCAATTGTTTTAATTACATAT
ACTAGTAATGTTGATATCTAATTCTTGTTGTAACATTTGAAAGTCAATAA
AGGAAAACGAAAATATTTTCGAAAATAAAAAAAAAAAAAAAAAA

MIP06012.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31345-RA 1083 CG31345-RA 30..1006 1..977 4885 100 Plus
CG10126.a 822 CG10126.a 114..244 209..339 190 76.3 Plus
CG10126-RB 859 CG10126-RB 151..281 209..339 190 76.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8636408..8636922 976..462 2560 99.8 Minus
chr3R 27901430 chr3R 8639039..8639189 283..133 755 100 Minus
chr3R 27901430 chr3R 8642154..8642287 134..1 670 100 Minus
chr3R 27901430 chr3R 8637214..8637338 403..279 625 100 Minus
chr3R 27901430 chr3R 8636983..8637044 461..400 280 96.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12811144..12811659 977..462 2580 100 Minus
3R 32079331 3R 12813773..12813923 283..133 755 100 Minus
3R 32079331 3R 12816888..12817021 134..1 670 100 Minus
3R 32079331 3R 12811950..12812074 403..279 625 100 Minus
3R 32079331 3R 12811720..12811781 461..400 310 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12551975..12552490 977..462 2580 100 Minus
3R 31820162 3R 12554604..12554754 283..133 755 100 Minus
3R 31820162 3R 12557719..12557852 134..1 670 100 Minus
3R 31820162 3R 12552781..12552905 403..279 625 100 Minus
3R 31820162 3R 12552551..12552612 461..400 310 100 Minus
Blast to na_te.dros performed 2019-03-15 14:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 2638..2687 854..901 110 72 Plus

MIP06012.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:52:25 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8637214..8637333 284..403 100 <- Minus
chr3R 8639039..8639187 135..283 100 <- Minus
chr3R 8642154..8642287 1..134 100   Minus
chr3R 8636408..8636922 462..976 99 <- Minus
chr3R 8636983..8637040 404..461 96 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:23 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
CG31345-RA 1..642 135..776 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:06 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
CG31345-RA 1..642 135..776 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:46:39 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
CG31345-RA 1..642 135..776 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:31 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
CG31345-RA 1..642 135..776 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-21 17:15:16 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
CG31345-RA 9..784 1..776 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:06 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
CG31345-RA 9..984 1..976 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:46:39 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
CG31345-RA 9..984 1..976 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:31 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
CG31345-RA 9..984 1..976 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:25 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12811145..12811659 462..976 100 <- Minus
3R 12811720..12811777 404..461 100 <- Minus
3R 12811950..12812069 284..403 100 <- Minus
3R 12813773..12813921 135..283 100 <- Minus
3R 12816888..12817021 1..134 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:25 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12811145..12811659 462..976 100 <- Minus
3R 12811720..12811777 404..461 100 <- Minus
3R 12811950..12812069 284..403 100 <- Minus
3R 12813773..12813921 135..283 100 <- Minus
3R 12816888..12817021 1..134 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:25 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12811145..12811659 462..976 100 <- Minus
3R 12811720..12811777 404..461 100 <- Minus
3R 12811950..12812069 284..403 100 <- Minus
3R 12813773..12813921 135..283 100 <- Minus
3R 12816888..12817021 1..134 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:46:39 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8642610..8642743 1..134 100   Minus
arm_3R 8637442..8637499 404..461 100 <- Minus
arm_3R 8637672..8637791 284..403 100 <- Minus
arm_3R 8639495..8639643 135..283 100 <- Minus
arm_3R 8636867..8637381 462..976 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:49 Download gff for MIP06012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12551976..12552490 462..976 100 <- Minus
3R 12552551..12552608 404..461 100 <- Minus
3R 12552781..12552900 284..403 100 <- Minus
3R 12554604..12554752 135..283 100 <- Minus
3R 12557719..12557852 1..134 100   Minus

MIP06012.pep Sequence

Translation from 134 to 775

> MIP06012.pep
MHRENAYSKEAELKNLAKRELANGLDKDPIYKLRLQCFSRGATGILGLSR
SFRVMDDDGSKSLSPEEFKKGVTDIGLDLTDSEIDEMFSRFDTDGSGNIN
MTEFLVKLRPPMNNSRISIIEKAFDKMDANGDGQITVTDLKNVYSVRDHP
KYLSGEMTENQIFTQFLKNFEVGAPNPDGIVTREEFINYYATISASIDND
AYFDLMMRQAYKL*

MIP06012.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18097-PA 213 GF18097-PA 1..213 1..213 995 85.9 Plus
Dana\GF18095-PA 227 GF18095-PA 21..227 7..213 735 67.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17096-PA 291 GG17096-PA 79..291 1..213 1104 96.7 Plus
Dere\GG17094-PA 227 GG17094-PA 21..225 7..211 719 65.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19207-PA 213 GH19207-PA 1..213 1..213 902 77.5 Plus
Dgri\GH19205-PA 215 GH19205-PA 9..215 7..213 758 70 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG31345-PA 213 CG31345-PA 1..213 1..213 1097 100 Plus
CG10126-PA 215 CG10126-PA 9..213 7..211 713 66.3 Plus
CG10126-PB 227 CG10126-PB 21..225 7..211 713 66.3 Plus
azot-PA 148 CG11165-PA 15..143 51..188 140 25.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24240-PA 216 GI24240-PA 4..216 1..213 838 71.8 Plus
Dmoj\GI24237-PA 215 GI24237-PA 9..215 7..213 785 71.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23161-PA 245 GL23161-PA 33..245 1..213 945 81.2 Plus
Dper\GL23159-PA 232 GL23159-PA 26..232 7..213 767 70 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16196-PB 213 GA16196-PB 1..213 1..213 942 80.8 Plus
Dpse\GA27168-PA 232 GA27168-PA 26..232 7..213 765 70 Plus
Dpse\GA27168-PB 215 GA27168-PB 9..215 7..213 763 70 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25978-PA 358 GM25978-PA 146..358 1..213 1123 99.1 Plus
Dsec\GM25975-PA 227 GM25975-PA 21..227 7..213 716 65.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20539-PA 275 GD20539-PA 63..275 1..213 1116 98.6 Plus
Dsim\GD20537-PA 227 GD20537-PA 21..227 7..213 706 65.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10815-PA 244 GJ10815-PA 32..244 1..213 839 70.4 Plus
Dvir\GJ10812-PA 215 GJ10812-PA 9..215 7..213 778 70.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10864-PA 213 GK10864-PA 1..213 1..213 936 80.8 Plus
Dwil\GK10861-PA 200 GK10861-PA 2..200 15..213 756 71.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24485-PA 213 GE24485-PA 1..213 1..213 1114 98.6 Plus
Dyak\GE24482-PA 227 GE24482-PA 21..225 7..211 723 66.3 Plus

MIP06012.hyp Sequence

Translation from 134 to 775

> MIP06012.hyp
MHRENAYSKEAELKNLAKRELANGLDKDPIYKLRLQCFSRGATGILGLSR
SFRVMDDDGSKSLSPEEFKKGVTDIGLDLTDSEIDEMFSRFDTDGSGNIN
MTEFLVKLRPPMNNSRISIIEKAFDKMDANGDGQITVTDLKNVYSVRDHP
KYLSGEMTENQIFTQFLKNFEVGAPNPDGIVTREEFINYYATISASIDND
AYFDLMMRQAYKL*

MIP06012.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG31345-PA 213 CG31345-PA 1..213 1..213 1097 100 Plus
CG10126-PA 215 CG10126-PA 9..213 7..211 713 66.3 Plus
CG10126-PB 227 CG10126-PB 21..225 7..211 713 66.3 Plus
CG11165-PA 148 CG11165-PA 15..143 51..188 140 25.2 Plus