Clone MIP06061 Report

Search the DGRC for MIP06061

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:60
Well:61
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43254-RA
Protein status:MIP06061.pep: gold
Sequenced Size:508

Clone Sequence Records

MIP06061.complete Sequence

508 bp assembled on 2009-02-24

GenBank Submission: BT072947.1

> MIP06061.complete
GCTATTGCTATTGGAGATGTCAAGATGGGGCGGTTGCTGTTTGTTCTTCT
GATTTGTTCCCCAATACTGTCAATTAAATTCCAAGCAAATGCAGAGGATA
ACTCAACAAAGAATGGCTTAGATCGAAACAGAGAAGGAGGAGGTCATAAG
GCGAATGTACCAGATGTTTCAAGGTTTCAAAGATCATGTTCAACTCAAGA
ATGTAAGGAAAAGGAATTCAATGATATCCTCGACTCCATTCTGAGCTCGG
AAACAACTACGGAGCCTGAACGGGAAGAGGCTCCACCGAGGAATGTTCCA
CAGAGACCAAATCGACCCTACATGGTTCGACCCAGCAGTAACGGGCACTT
TCTTCATGACATTGTAACTTGGGTTGAAAGAACAAAGAGGGCAATATTTG
GATTTGGATAACATTTTTTTGCATAGTTACTTTCAAGTGAAATAAAAAGT
ATTCACCAATATTTAAAATAGGCTCAGCGATAAAAAAAAAAAAAAAAAAA
AAAAAAAA

MIP06061.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
nc_15185.a 480 nc_15185.a 1..480 1..480 2400 100 Plus
MB8.chr3R.pasa.66.a 480 MB8.chr3R.pasa.66.a 1..480 1..480 2400 100 Plus
MB8.chr3R.pasa.72.a 565 MB8.chr3R.pasa.72.a 224..565 139..480 1710 100 Plus
MB8.chr3R.pasa.72.a 565 MB8.chr3R.pasa.72.a 74..213 1..140 700 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3565024..3565306 480..198 1415 100 Minus
chr3R 27901430 chr3R 3565484..3565623 140..1 700 100 Minus
chr3R 27901430 chr3R 3565356..3565417 199..138 310 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7738964..7739246 480..198 1415 100 Minus
3R 32079331 3R 7739424..7739563 140..1 700 100 Minus
3R 32079331 3R 7739296..7739357 199..138 310 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7479795..7480077 480..198 1415 100 Minus
3R 31820162 3R 7480255..7480394 140..1 700 100 Minus
3R 31820162 3R 7480127..7480188 199..138 310 100 Minus
Blast to na_te.dros performed on 2019-03-17 00:12:36 has no hits.

MIP06061.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:13:23 Download gff for MIP06061.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3565023..3565304 200..481 99 <- Minus
chr3R 3565356..3565415 140..199 100 <- Minus
chr3R 3565485..3565623 1..139 100   Minus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:31:36 Download gff for MIP06061.complete
Subject Subject Range Query Range Percent Splice Strand
CG43254-RA 1..387 25..411 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:14:07 Download gff for MIP06061.complete
Subject Subject Range Query Range Percent Splice Strand
CG43254-RA 1..387 25..411 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:31:36 Download gff for MIP06061.complete
Subject Subject Range Query Range Percent Splice Strand
CG43254-RA 1..479 1..479 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:14:07 Download gff for MIP06061.complete
Subject Subject Range Query Range Percent Splice Strand
CG43254-RA 1..479 1..479 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:23 Download gff for MIP06061.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7738963..7739244 200..481 99 <- Minus
3R 7739296..7739355 140..199 100 <- Minus
3R 7739425..7739563 1..139 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:23 Download gff for MIP06061.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7738963..7739244 200..481 99 <- Minus
3R 7739296..7739355 140..199 100 <- Minus
3R 7739425..7739563 1..139 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:23 Download gff for MIP06061.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7738963..7739244 200..481 99 <- Minus
3R 7739296..7739355 140..199 100 <- Minus
3R 7739425..7739563 1..139 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:31:36 Download gff for MIP06061.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3564685..3564966 200..481 99 <- Minus
arm_3R 3565018..3565077 140..199 100 <- Minus
arm_3R 3565147..3565285 1..139 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:29 Download gff for MIP06061.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7479794..7480075 200..481 99 <- Minus
3R 7480127..7480186 140..199 100 <- Minus
3R 7480256..7480394 1..139 100   Minus

MIP06061.pep Sequence

Translation from 0 to 410

> MIP06061.pep
AIAIGDVKMGRLLFVLLICSPILSIKFQANAEDNSTKNGLDRNREGGGHK
ANVPDVSRFQRSCSTQECKEKEFNDILDSILSSETTTEPEREEAPPRNVP
QRPNRPYMVRPSSNGHFLHDIVTWVERTKRAIFGFG*

MIP06061.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG43254-PA 128 CG43254-PA 1..128 9..136 678 100 Plus
CG43254-PB 132 CG43254-PB 1..132 9..136 663 97 Plus

MIP06061.hyp Sequence

Translation from 0 to 410

> MIP06061.hyp
AIAIGDVKMGRLLFVLLICSPILSIKFQANAEDNSTKNGLDRNREGGGHK
ANVPDVSRFQRSCSTQECKEKEFNDILDSILSSETTTEPEREEAPPRNVP
QRPNRPYMVRPSSNGHFLHDIVTWVERTKRAIFGFG*

MIP06061.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG43254-PA 128 CG43254-PA 1..128 9..136 678 100 Plus
CG43254-PB 132 CG43254-PB 1..132 9..136 663 97 Plus