Clone MIP06151 Report

Search the DGRC for MIP06151

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:61
Well:51
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43061-RA
Protein status:MIP06151.pep: gold
Sequenced Size:321

Clone Sequence Records

MIP06151.complete Sequence

321 bp assembled on 2011-03-08

GenBank Submission: BT126127.1

> MIP06151.complete
AAGATGTTGATTGCCCGACTTGGATTCTTGTTGTGCTCATTGGGCCTTGC
AACTGCCATATGTCAAACGAATGGGGAAAGTTGTAAGTCGCATGCGGATT
GCTGCTCCACGATGTGCCTGACCCAACTGGGTCAGTGTTCACCCAAAAGG
GGAGATCAGTGGTAATTACTTGCCGTTTGTCTTGGGCCACTAATCAGAAA
CTTTTGTTGCATCACCTCATATTGCCAGCTTATACCCTTTCATCTGGTTA
CACATTCATTCGACCGGCAATAAGAATAAAGCAGTGCCGCATCAACCGAC
AGTAAAAAAAAAAAAAAAAAA

MIP06151.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3875898..3876119 82..303 1095 99.5 Plus
chr3R 27901430 chr3R 17559670..17559891 303..82 1035 97.7 Minus
chr3R 27901430 chr3R 3875759..3875839 1..81 405 100 Plus
chr3R 27901430 chr3R 17559951..17560031 81..1 375 97.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8049838..8050060 82..304 1115 100 Plus
3R 32079331 3R 21735909..21736130 303..82 1035 97.7 Minus
3R 32079331 3R 8049699..8049779 1..81 405 100 Plus
3R 32079331 3R 21736190..21736270 81..1 375 97.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7790669..7790891 82..304 1115 100 Plus
3R 31820162 3R 21476740..21476961 303..82 1035 97.7 Minus
3R 31820162 3R 7790530..7790610 1..81 405 100 Plus
3R 31820162 3R 21477021..21477101 81..1 375 97.5 Minus
Blast to na_te.dros performed on 2019-03-16 22:19:00 has no hits.

MIP06151.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:19:41 Download gff for MIP06151.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3875759..3875839 1..81 100 -> Plus
chr3R 3875898..3876119 82..303 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-08 09:24:25 Download gff for MIP06151.complete
Subject Subject Range Query Range Percent Splice Strand
CG43061-RA 1..162 4..165 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:06 Download gff for MIP06151.complete
Subject Subject Range Query Range Percent Splice Strand
CG43061-RA 1..162 4..165 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:26:33 Download gff for MIP06151.complete
Subject Subject Range Query Range Percent Splice Strand
CG43061-RA 1..162 4..165 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-08 09:24:24 Download gff for MIP06151.complete
Subject Subject Range Query Range Percent Splice Strand
CG43061-RA 27..322 1..296 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:06 Download gff for MIP06151.complete
Subject Subject Range Query Range Percent Splice Strand
CG43061-RA 27..329 1..303 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:33 Download gff for MIP06151.complete
Subject Subject Range Query Range Percent Splice Strand
CG43061-RA 27..329 1..303 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:41 Download gff for MIP06151.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8049699..8049779 1..81 100 -> Plus
3R 8049838..8050059 82..303 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:41 Download gff for MIP06151.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8049699..8049779 1..81 100 -> Plus
3R 8049838..8050059 82..303 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:41 Download gff for MIP06151.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8049699..8049779 1..81 100 -> Plus
3R 8049838..8050059 82..303 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:06 Download gff for MIP06151.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3875421..3875501 1..81 100 -> Plus
arm_3R 3875560..3875781 82..303 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:51 Download gff for MIP06151.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7790669..7790890 82..303 100   Plus
3R 7790530..7790610 1..81 100 -> Plus

MIP06151.hyp Sequence

Translation from 0 to 164

> MIP06151.hyp
KMLIARLGFLLCSLGLATAICQTNGESCKSHADCCSTMCLTQLGQCSPKR
GDQW*

MIP06151.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG43061-PA 53 CG43061-PA 1..53 2..54 294 100 Plus
Sfp93F-PA 53 CG42608-PA 1..53 2..54 285 96.2 Plus

MIP06151.pep Sequence

Translation from 0 to 164

> MIP06151.pep
KMLIARLGFLLCSLGLATAICQTNGESCKSHADCCSTMCLTQLGQCSPKR
GDQW*

MIP06151.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG43061-PA 53 CG43061-PA 1..53 2..54 294 100 Plus
Sfp93F-PA 53 CG42608-PA 1..53 2..54 285 96.2 Plus