MIP06151.complete Sequence
321 bp assembled on 2011-03-08
GenBank Submission: BT126127.1
> MIP06151.complete
AAGATGTTGATTGCCCGACTTGGATTCTTGTTGTGCTCATTGGGCCTTGC
AACTGCCATATGTCAAACGAATGGGGAAAGTTGTAAGTCGCATGCGGATT
GCTGCTCCACGATGTGCCTGACCCAACTGGGTCAGTGTTCACCCAAAAGG
GGAGATCAGTGGTAATTACTTGCCGTTTGTCTTGGGCCACTAATCAGAAA
CTTTTGTTGCATCACCTCATATTGCCAGCTTATACCCTTTCATCTGGTTA
CACATTCATTCGACCGGCAATAAGAATAAAGCAGTGCCGCATCAACCGAC
AGTAAAAAAAAAAAAAAAAAA
MIP06151.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:19:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 3875898..3876119 | 82..303 | 1095 | 99.5 | Plus |
chr3R | 27901430 | chr3R | 17559670..17559891 | 303..82 | 1035 | 97.7 | Minus |
chr3R | 27901430 | chr3R | 3875759..3875839 | 1..81 | 405 | 100 | Plus |
chr3R | 27901430 | chr3R | 17559951..17560031 | 81..1 | 375 | 97.5 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 8049838..8050060 | 82..304 | 1115 | 100 | Plus |
3R | 32079331 | 3R | 21735909..21736130 | 303..82 | 1035 | 97.7 | Minus |
3R | 32079331 | 3R | 8049699..8049779 | 1..81 | 405 | 100 | Plus |
3R | 32079331 | 3R | 21736190..21736270 | 81..1 | 375 | 97.5 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 7790669..7790891 | 82..304 | 1115 | 100 | Plus |
3R | 31820162 | 3R | 21476740..21476961 | 303..82 | 1035 | 97.7 | Minus |
3R | 31820162 | 3R | 7790530..7790610 | 1..81 | 405 | 100 | Plus |
3R | 31820162 | 3R | 21477021..21477101 | 81..1 | 375 | 97.5 | Minus |
Blast to na_te.dros performed on 2019-03-16 22:19:00 has no hits.
MIP06151.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:19:41 Download gff for
MIP06151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 3875759..3875839 | 1..81 | 100 | -> | Plus |
chr3R | 3875898..3876119 | 82..303 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-08 09:24:25 Download gff for
MIP06151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43061-RA | 1..162 | 4..165 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:06 Download gff for
MIP06151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43061-RA | 1..162 | 4..165 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:26:33 Download gff for
MIP06151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43061-RA | 1..162 | 4..165 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-08 09:24:24 Download gff for
MIP06151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43061-RA | 27..322 | 1..296 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:06 Download gff for
MIP06151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43061-RA | 27..329 | 1..303 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:33 Download gff for
MIP06151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43061-RA | 27..329 | 1..303 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:41 Download gff for
MIP06151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8049699..8049779 | 1..81 | 100 | -> | Plus |
3R | 8049838..8050059 | 82..303 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:41 Download gff for
MIP06151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8049699..8049779 | 1..81 | 100 | -> | Plus |
3R | 8049838..8050059 | 82..303 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:41 Download gff for
MIP06151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8049699..8049779 | 1..81 | 100 | -> | Plus |
3R | 8049838..8050059 | 82..303 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:06 Download gff for
MIP06151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 3875421..3875501 | 1..81 | 100 | -> | Plus |
arm_3R | 3875560..3875781 | 82..303 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:51 Download gff for
MIP06151.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7790669..7790890 | 82..303 | 100 | | Plus |
3R | 7790530..7790610 | 1..81 | 100 | -> | Plus |
MIP06151.hyp Sequence
Translation from 0 to 164
> MIP06151.hyp
KMLIARLGFLLCSLGLATAICQTNGESCKSHADCCSTMCLTQLGQCSPKR
GDQW*
MIP06151.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43061-PA | 53 | CG43061-PA | 1..53 | 2..54 | 294 | 100 | Plus |
Sfp93F-PA | 53 | CG42608-PA | 1..53 | 2..54 | 285 | 96.2 | Plus |
MIP06151.pep Sequence
Translation from 0 to 164
> MIP06151.pep
KMLIARLGFLLCSLGLATAICQTNGESCKSHADCCSTMCLTQLGQCSPKR
GDQW*
MIP06151.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43061-PA | 53 | CG43061-PA | 1..53 | 2..54 | 294 | 100 | Plus |
Sfp93F-PA | 53 | CG42608-PA | 1..53 | 2..54 | 285 | 96.2 | Plus |