MIP06209.complete Sequence
367 bp assembled on 2009-02-23
GenBank Submission: BT066318.1
> MIP06209.complete
ACGAAATGAAGTTCTTCATTTTGATTTCATTCTTACTGGTCTGTCAAGGG
TCCAACGAAGAGGAGGATAACATAATAGCCGAGTTGTGCTTCAATCCGAA
TTCTGGACCTCCTTGCCAGAAATTAAAAACATATTATTGGGATAAGGAAA
AGAATCGATGCGTGCTCTCTCGGTATTTAATGCAGCCTTGTGGTTTCTTT
GACACAATAGACATGTGCGATAAAATATGCACCAAGGAATCGTGGACAAT
ATCTCATTTGGAAGTATATGTTCGAAATATGCCTTAAAATATACTTGTTT
TTCAGCTGCCAATTGACATTTAAGAAGTGGTCACGCTTATTAAAAAAAAA
AAAAAAAAAAAAAAAAA
MIP06209.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:24:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A1-RA | 363 | Sfp33A1-RA | 19..361 | 1..343 | 1715 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:35:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 11752749..11753018 | 341..81 | 1165 | 96.3 | Minus |
chr2L | 23010047 | chr2L | 11753077..11753157 | 81..1 | 390 | 98.8 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:35:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11754083..11754345 | 343..81 | 1315 | 100 | Minus |
2L | 23513712 | 2L | 11754404..11754484 | 81..1 | 405 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11754083..11754345 | 343..81 | 1315 | 100 | Minus |
2L | 23513712 | 2L | 11754404..11754484 | 81..1 | 405 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 19:35:45 has no hits.
MIP06209.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:36:44 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 11752749..11753017 | 82..341 | 96 | <- | Minus |
chr2L | 11753077..11753157 | 1..81 | 98 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:28 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A1-RA | 1..282 | 6..287 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:36:00 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A1-RA | 1..282 | 6..287 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:39 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A1-RA | 1..282 | 6..287 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:36:38 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A1-RA | 1..282 | 6..287 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-23 16:45:28 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A1-RA | 19..323 | 1..305 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:36:00 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A1-RA | 19..359 | 1..341 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:39 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A1-RA | 19..359 | 1..341 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:36:38 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A1-RA | 19..359 | 1..341 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:36:44 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11754085..11754344 | 82..341 | 100 | <- | Minus |
2L | 11754404..11754484 | 1..81 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:36:44 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11754085..11754344 | 82..341 | 100 | <- | Minus |
2L | 11754404..11754484 | 1..81 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:36:44 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11754085..11754344 | 82..341 | 100 | <- | Minus |
2L | 11754404..11754484 | 1..81 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:39 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11754085..11754344 | 82..341 | 100 | <- | Minus |
arm_2L | 11754404..11754484 | 1..81 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:09:31 Download gff for
MIP06209.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11754085..11754344 | 82..341 | 100 | <- | Minus |
2L | 11754404..11754484 | 1..81 | 100 | | Minus |
MIP06209.pep Sequence
Translation from 2 to 286
> MIP06209.pep
EMKFFILISFLLVCQGSNEEEDNIIAELCFNPNSGPPCQKLKTYYWDKEK
NRCVLSRYLMQPCGFFDTIDMCDKICTKESWTISHLEVYVRNMP*
MIP06209.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A1-PA | 93 | CG42472-PA | 1..93 | 2..94 | 520 | 100 | Plus |
MIP06209.hyp Sequence
Translation from 2 to 286
> MIP06209.hyp
EMKFFILISFLLVCQGSNEEEDNIIAELCFNPNSGPPCQKLKTYYWDKEK
NRCVLSRYLMQPCGFFDTIDMCDKICTKESWTISHLEVYVRNMP*
MIP06209.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:27:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A1-PA | 93 | CG42472-PA | 1..93 | 2..94 | 520 | 100 | Plus |