Clone MIP06223 Report

Search the DGRC for MIP06223

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:62
Well:23
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptSfp24C1-RA
Protein status:MIP06223.pep: gold
Sequenced Size:360

Clone Sequence Records

MIP06223.complete Sequence

360 bp assembled on 2009-02-24

GenBank Submission: BT072948.1

> MIP06223.complete
TTTGCGATGAGGTCGTTTTGTATATTGGCCTTATTAATAACCCTTAAGTT
CGAAATGGGATATGGAAATTCTGTCTGCAATCTTCAGGCCACATTCATTG
GATGGTGTAAAATGACTATAAGAGGATTTACTTTCGTAGCTTCCAAAAAC
GCATGCCGTAGAATTTCTGGACCATGTGCTGCACAGGATAACTTTTTCAT
GGACAAAGCTTCCTGCGAAACAGCATGCAAAAAAATAATATTACCTTGAA
ATCGTCGAGCGATTTATATTTATATTTATTTATTTATATTTGCTAGGATG
TGCTTCAAATTAACTATTAAAATCGTTTCCGATTCTTTAAAGTAAAAAAA
AAAAAAAAAA

MIP06223.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24C1-RA 363 Sfp24C1-RA 21..363 1..343 1715 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3700322..3700594 71..343 1365 100 Plus
chr2L 23010047 chr2L 3700196..3700265 1..70 350 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3700820..3701093 71..344 1370 100 Plus
2L 23513712 2L 3700694..3700763 1..70 350 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3700820..3701093 71..344 1370 100 Plus
2L 23513712 2L 3700694..3700763 1..70 350 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:36:14 has no hits.

MIP06223.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:37:00 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3700196..3700265 1..70 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:31 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 1..243 7..249 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:36 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 1..243 7..249 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:57 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 1..243 7..249 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:37:11 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 1..243 7..249 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-24 15:36:16 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 21..359 1..339 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:36 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 21..359 1..339 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:57 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 21..363 1..343 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:37:11 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 21..363 1..343 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:37:00 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3700694..3700763 1..70 100 -> Plus
2L 3700820..3701092 71..343 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:37:00 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3700694..3700763 1..70 100 -> Plus
2L 3700820..3701092 71..343 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:37:00 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3700694..3700763 1..70 100 -> Plus
2L 3700820..3701092 71..343 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:57 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3700820..3701092 71..343 100   Plus
arm_2L 3700694..3700763 1..70 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:24 Download gff for MIP06223.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3700820..3701092 71..343 100   Plus
2L 3700694..3700763 1..70 100 -> Plus

MIP06223.pep Sequence

Translation from 0 to 248

> MIP06223.pep
FAMRSFCILALLITLKFEMGYGNSVCNLQATFIGWCKMTIRGFTFVASKN
ACRRISGPCAAQDNFFMDKASCETACKKIILP*

MIP06223.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24C1-PA 80 CG42466-PA 1..80 3..82 430 100 Plus
CG42467-PA 82 CG42467-PA 1..81 3..80 143 40.7 Plus

MIP06223.hyp Sequence

Translation from 0 to 248

> MIP06223.hyp
FAMRSFCILALLITLKFEMGYGNSVCNLQATFIGWCKMTIRGFTFVASKN
ACRRISGPCAAQDNFFMDKASCETACKKIILP*

MIP06223.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24C1-PA 80 CG42466-PA 1..80 3..82 430 100 Plus
CG42467-PA 82 CG42467-PA 1..81 3..80 143 40.7 Plus