MIP06223.complete Sequence
360 bp assembled on 2009-02-24
GenBank Submission: BT072948.1
> MIP06223.complete
TTTGCGATGAGGTCGTTTTGTATATTGGCCTTATTAATAACCCTTAAGTT
CGAAATGGGATATGGAAATTCTGTCTGCAATCTTCAGGCCACATTCATTG
GATGGTGTAAAATGACTATAAGAGGATTTACTTTCGTAGCTTCCAAAAAC
GCATGCCGTAGAATTTCTGGACCATGTGCTGCACAGGATAACTTTTTCAT
GGACAAAGCTTCCTGCGAAACAGCATGCAAAAAAATAATATTACCTTGAA
ATCGTCGAGCGATTTATATTTATATTTATTTATTTATATTTGCTAGGATG
TGCTTCAAATTAACTATTAAAATCGTTTCCGATTCTTTAAAGTAAAAAAA
AAAAAAAAAA
MIP06223.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:25:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp24C1-RA | 363 | Sfp24C1-RA | 21..363 | 1..343 | 1715 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:36:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 3700322..3700594 | 71..343 | 1365 | 100 | Plus |
chr2L | 23010047 | chr2L | 3700196..3700265 | 1..70 | 350 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:36:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3700820..3701093 | 71..344 | 1370 | 100 | Plus |
2L | 23513712 | 2L | 3700694..3700763 | 1..70 | 350 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3700820..3701093 | 71..344 | 1370 | 100 | Plus |
2L | 23513712 | 2L | 3700694..3700763 | 1..70 | 350 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 19:36:14 has no hits.
MIP06223.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:37:00 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 3700196..3700265 | 1..70 | 100 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:31 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 1..243 | 7..249 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:36 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 1..243 | 7..249 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:57 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 1..243 | 7..249 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:37:11 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 1..243 | 7..249 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-24 15:36:16 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 21..359 | 1..339 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:36 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 21..359 | 1..339 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:57 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 21..363 | 1..343 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:37:11 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 21..363 | 1..343 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:37:00 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3700694..3700763 | 1..70 | 100 | -> | Plus |
2L | 3700820..3701092 | 71..343 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:37:00 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3700694..3700763 | 1..70 | 100 | -> | Plus |
2L | 3700820..3701092 | 71..343 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:37:00 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3700694..3700763 | 1..70 | 100 | -> | Plus |
2L | 3700820..3701092 | 71..343 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:57 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3700820..3701092 | 71..343 | 100 | | Plus |
arm_2L | 3700694..3700763 | 1..70 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:24 Download gff for
MIP06223.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3700820..3701092 | 71..343 | 100 | | Plus |
2L | 3700694..3700763 | 1..70 | 100 | -> | Plus |
MIP06223.pep Sequence
Translation from 0 to 248
> MIP06223.pep
FAMRSFCILALLITLKFEMGYGNSVCNLQATFIGWCKMTIRGFTFVASKN
ACRRISGPCAAQDNFFMDKASCETACKKIILP*
MIP06223.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp24C1-PA | 80 | CG42466-PA | 1..80 | 3..82 | 430 | 100 | Plus |
CG42467-PA | 82 | CG42467-PA | 1..81 | 3..80 | 143 | 40.7 | Plus |
MIP06223.hyp Sequence
Translation from 0 to 248
> MIP06223.hyp
FAMRSFCILALLITLKFEMGYGNSVCNLQATFIGWCKMTIRGFTFVASKN
ACRRISGPCAAQDNFFMDKASCETACKKIILP*
MIP06223.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp24C1-PA | 80 | CG42466-PA | 1..80 | 3..82 | 430 | 100 | Plus |
CG42467-PA | 82 | CG42467-PA | 1..81 | 3..80 | 143 | 40.7 | Plus |