Clone MIP06238 Report

Search the DGRC for MIP06238

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:62
Well:38
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43057-RA
Protein status:MIP06238.pep: gold
Sequenced Size:594

Clone Sequence Records

MIP06238.complete Sequence

594 bp assembled on 2011-03-08

GenBank Submission: BT126128.1

> MIP06238.complete
ATCTGATGATCCGTCATGAAGCTACTGCTGTTGGCGGTGATTGTTGCCCT
CGCTTGGCTTCTTATAGAGGCTGGCAAGACCAGGACTAAGAACAGCTCCT
GTCTGGTGAAAAACAAATATCCCCCCGAATCTTCTTGTAGATCATCGCAT
CGGGAATTCTTTGCCTTTCACCGAGTTCTATTCGACTGCATAAAGGTGAC
CACAAATTGCCGCAAGATCTACAGGAGGAATGAGTTCCATAGTTTGCAAT
CGTGCAGAGATGCATGTCACTACCACATGGCTGAACCAAGTCCGCCACCA
CCCCAAAATGGTACGACTTCTGCACCTGGAGGTGCCTCCGGAGCGCCAGG
AGACGCTCCAGCAGCTGAAACGCCAGCTGCAGCGTGATCTTCAGGATCGG
ACACAAAAAAGATCAATTTAATTAAATTCCCGCAGATATTTGAAATAACT
TATAGAGAGCATTGTGATAATTTCAATTCGGTATTTTCTGTATATTTAAT
CACTGTGTGTGCACCGCATTACCAATTTTTTTTTGCCCTCGTATTTACAA
CTACATGATTTGCAAGACTCATAATACAAAAAAAAAAAAAAAAA

MIP06238.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8242295..8242679 577..193 1880 99.2 Minus
chr2L 23010047 chr2L 8242729..8242838 197..88 520 98.2 Minus
chr2L 23010047 chr2L 8242896..8242987 92..1 445 98.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8243320..8243707 580..193 1940 100 Minus
2L 23513712 2L 8243757..8243868 197..86 560 100 Minus
2L 23513712 2L 8243913..8244003 91..1 440 98.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8243320..8243707 580..193 1940 100 Minus
2L 23513712 2L 8243757..8243868 197..86 560 100 Minus
2L 23513712 2L 8243913..8244003 91..1 440 98.9 Minus
Blast to na_te.dros performed 2019-03-16 22:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 700..799 403..503 124 59.4 Plus

MIP06238.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:19:44 Download gff for MIP06238.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8242295..8242676 196..577 99 <- Minus
chr2L 8242731..8242840 86..195 97 <- Minus
chr2L 8242903..8242987 1..85 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-08 15:11:29 Download gff for MIP06238.complete
Subject Subject Range Query Range Percent Splice Strand
CG43057-RA 1..372 16..387 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:13 Download gff for MIP06238.complete
Subject Subject Range Query Range Percent Splice Strand
CG43057-RA 1..372 16..387 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:26:40 Download gff for MIP06238.complete
Subject Subject Range Query Range Percent Splice Strand
CG43057-RA 1..372 16..387 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-08 15:11:28 Download gff for MIP06238.complete
Subject Subject Range Query Range Percent Splice Strand
CG43057-RA 1..372 16..387 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:13 Download gff for MIP06238.complete
Subject Subject Range Query Range Percent Splice Strand
CG43057-RB 1..577 1..577 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:40 Download gff for MIP06238.complete
Subject Subject Range Query Range Percent Splice Strand
CG43057-RB 1..577 1..577 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:44 Download gff for MIP06238.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8243323..8243704 196..577 100 <- Minus
2L 8243759..8243868 86..195 100 <- Minus
2L 8243919..8244003 1..85 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:44 Download gff for MIP06238.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8243323..8243704 196..577 100 <- Minus
2L 8243759..8243868 86..195 100 <- Minus
2L 8243919..8244003 1..85 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:44 Download gff for MIP06238.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8243323..8243704 196..577 100 <- Minus
2L 8243759..8243868 86..195 100 <- Minus
2L 8243919..8244003 1..85 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:13 Download gff for MIP06238.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8243323..8243704 196..577 100 <- Minus
arm_2L 8243759..8243868 86..195 100 <- Minus
arm_2L 8243919..8244003 1..85 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:54 Download gff for MIP06238.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8243323..8243704 196..577 100 <- Minus
2L 8243759..8243868 86..195 100 <- Minus
2L 8243919..8244003 1..85 100   Minus

MIP06238.hyp Sequence

Translation from 15 to 386

> MIP06238.hyp
MKLLLLAVIVALAWLLIEAGKTRTKNSSCLVKNKYPPESSCRSSHREFFA
FHRVLFDCIKVTTNCRKIYRRNEFHSLQSCRDACHYHMAEPSPPPPQNGT
TSAPGGASGAPGDAPAAETPAAA*

MIP06238.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG43057-PB 123 CG43057-PB 1..123 1..123 661 100 Plus
CG43057-PA 123 CG43057-PA 1..123 1..123 661 100 Plus

MIP06238.pep Sequence

Translation from 15 to 386

> MIP06238.pep
MKLLLLAVIVALAWLLIEAGKTRTKNSSCLVKNKYPPESSCRSSHREFFA
FHRVLFDCIKVTTNCRKIYRRNEFHSLQSCRDACHYHMAEPSPPPPQNGT
TSAPGGASGAPGDAPAAETPAAA*

MIP06238.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23462-PA 124 GG23462-PA 1..110 1..110 440 70.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG43057-PB 123 CG43057-PB 1..123 1..123 661 100 Plus
CG43057-PA 123 CG43057-PA 1..123 1..123 661 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19390-PA 115 GL19390-PA 1..111 1..113 192 37.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20813-PA 1909 GA20813-PA 1447..1528 25..102 200 47.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13117-PA 126 GM13117-PA 1..112 1..112 507 91.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20592-PA 1453 GJ20592-PA 1087..1149 26..88 185 46 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11088-PA 95 GE11088-PA 1..93 1..120 333 60.2 Plus