Clone MIP06274 Report

Search the DGRC for MIP06274

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:62
Well:74
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG8331-RC
Protein status:MIP06274.pep: gold
Sequenced Size:678

Clone Sequence Records

MIP06274.complete Sequence

678 bp assembled on 2009-02-24

GenBank Submission: BT070223.1

> MIP06274.complete
GGCGAACATGGCAGTCGAGGAATTAGAGAGCAAAATTGTCCAACTGTTCG
TAGAGAACCCCCTCCTGCGCTACGGTGCTGTTGGTCTGTGCGCCATCTAC
CTGATCTTTGGCTGGGGCGCCCAACTACTGTGCAACATCATTGGGGTTCT
GTACCCTGCATATATTTCCATCCATGCCATCGAGTCCAGCACAAAGCAGG
ACGACACCAAGTGGCTGATCTACTGGGTCACGTTTGGAATCTTCACCGTG
ATTGAATTCTTTTCGAGTCTGCTAACTTCGGTGATTCCCTTTTACTGGCT
GCTGAAGTGTGCTTTCCTCATCTGGTGCATGCTGCCCACGGAACAGAATG
GTTCTACCATCATCTACAACAAGCTGGTGCGACCCTACTTCCTGAAACAT
CACGAATCCGTTGACAGGATCATCGATGATGGCATGAAGAAAGCCGCTGG
AGTGCTGAAGCATGACTAGAAGGCGAATGTACCGTAGCTCCGACCGCTTC
TCGCTTATCCATGCATTTGGTTTTGGGCCTGGTCACCAACCTCACCTCGT
ATTGGTTACGTTTTGCAATAAATTTTAATTCTGTATTCATTTTGTTGTTG
ATAAGAGCACCAGTGTTCGCTGAACCAGAAGAAATCTCCGTTTGTTAAAC
GTAAAAACGAAAAAAAAAAAAAAAAAAA

MIP06274.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG8331.a 657 CG8331.a 6..657 1..652 3260 100 Plus
CG8331-RA 942 CG8331-RA 358..942 74..658 2925 100 Plus
CG8331.b 929 CG8331.b 345..929 74..658 2925 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10060056..10060307 408..659 1260 100 Plus
chr2R 21145070 chr2R 10059598..10059831 74..307 1170 100 Plus
chr3R 27901430 chr3R 21609728..21610059 420..89 1105 88.9 Minus
chr2R 21145070 chr2R 10059891..10059992 306..407 510 100 Plus
chr2R 21145070 chr2R 10059462..10059537 1..76 380 100 Plus
chr3R 27901430 chr3R 21609531..21609680 657..508 345 82 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14172747..14173002 408..663 1280 100 Plus
2R 25286936 2R 14172289..14172522 74..307 1170 100 Plus
3R 32079331 3R 25786726..25787057 420..89 1090 88.6 Minus
2R 25286936 2R 14172582..14172683 306..407 510 100 Plus
2R 25286936 2R 14172153..14172228 1..76 380 100 Plus
3R 32079331 3R 25786524..25786678 662..508 355 81.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14173946..14174201 408..663 1280 100 Plus
2R 25260384 2R 14173488..14173721 74..307 1170 100 Plus
3R 31820162 3R 25527557..25527888 420..89 1090 88.5 Minus
2R 25260384 2R 14173781..14173882 306..407 510 100 Plus
2R 25260384 2R 14173352..14173427 1..76 380 100 Plus
3R 31820162 3R 25527355..25527509 662..508 355 81.9 Minus
Blast to na_te.dros performed 2019-03-17 00:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 5241..5263 570..592 106 95.7 Plus

MIP06274.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:13:26 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10059462..10059535 1..74 100 -> Plus
chr2R 10059599..10059831 75..307 100 -> Plus
chr2R 10059893..10059992 308..407 100 -> Plus
chr2R 10060056..10060307 408..659 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:37 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RA 138..537 68..469 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:48 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RC 1..462 8..469 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:31:45 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RC 1..462 8..469 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:14:13 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RC 1..462 8..469 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-25 08:39:41 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RA 253..765 68..582 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:48 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RC 1..659 1..659 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:31:45 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RC 365..1023 1..659 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:14:13 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RC 365..1023 1..659 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:26 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14172584..14172683 308..407 100 -> Plus
2R 14172747..14172998 408..659 100   Plus
2R 14172153..14172226 1..74 100 -> Plus
2R 14172290..14172522 75..307 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:26 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14172584..14172683 308..407 100 -> Plus
2R 14172747..14172998 408..659 100   Plus
2R 14172153..14172226 1..74 100 -> Plus
2R 14172290..14172522 75..307 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:26 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14172584..14172683 308..407 100 -> Plus
2R 14172747..14172998 408..659 100   Plus
2R 14172153..14172226 1..74 100 -> Plus
2R 14172290..14172522 75..307 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:31:45 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10059658..10059731 1..74 100 -> Plus
arm_2R 10059795..10060027 75..307 100 -> Plus
arm_2R 10060089..10060188 308..407 100 -> Plus
arm_2R 10060252..10060503 408..659 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:38 Download gff for MIP06274.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14173489..14173721 75..307 100 -> Plus
2R 14173783..14173882 308..407 100 -> Plus
2R 14173946..14174197 408..659 100   Plus
2R 14173352..14173425 1..74 100 -> Plus

MIP06274.hyp Sequence

Translation from 0 to 468

> MIP06274.hyp
ANMAVEELESKIVQLFVENPLLRYGAVGLCAIYLIFGWGAQLLCNIIGVL
YPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWL
LKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKKAAG
VLKHD*

MIP06274.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG8331-PC 153 CG8331-PC 1..153 3..155 812 100 Plus
CG8331-PB 160 CG8331-PB 27..160 22..155 707 98.5 Plus
CG8331-PD 178 CG8331-PD 48..178 25..155 706 100 Plus
CG8331-PA 178 CG8331-PA 48..178 25..155 706 100 Plus
CG4960-PB 174 CG4960-PB 33..174 4..155 536 69.1 Plus

MIP06274.pep Sequence

Translation from 1 to 468

> MIP06274.pep
ANMAVEELESKIVQLFVENPLLRYGAVGLCAIYLIFGWGAQLLCNIIGVL
YPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWL
LKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKKAAG
VLKHD*

MIP06274.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12032-PA 181 GF12032-PA 51..181 25..155 650 92.4 Plus
Dana\GF13556-PA 290 GF13556-PA 7..114 40..148 204 32.1 Plus
Dana\GF20320-PA 267 GF20320-PA 1..109 34..141 166 30 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20429-PA 181 GG20429-PA 51..181 25..155 656 92.4 Plus
Dere\GG12216-PA 164 GG12216-PA 51..164 25..138 557 88.6 Plus
Dere\GG22816-PA 285 GG22816-PA 7..114 40..148 205 32.1 Plus
Dere\GG18428-PA 244 GG18428-PA 1..108 34..141 163 30 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21843-PA 181 GH21843-PA 43..181 17..155 591 77.7 Plus
Dgri\GH20967-PA 281 GH20967-PA 7..114 40..148 194 30.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
ReepB-PC 153 CG8331-PC 1..153 3..155 812 100 Plus
ReepB-PB 160 CG8331-PB 27..160 22..155 707 98.5 Plus
ReepB-PD 178 CG8331-PD 48..178 25..155 706 100 Plus
ReepB-PA 178 CG8331-PA 48..178 25..155 706 100 Plus
CG4960-PB 174 CG4960-PB 33..174 4..155 536 69.1 Plus
CG4960-PA 174 CG4960-PA 33..174 4..155 536 69.1 Plus
ReepA-PO 291 CG42678-PO 148..260 30..147 212 33.9 Plus
ReepA-PD 435 CG30193-PD 148..260 30..147 212 33.9 Plus
ReepA-PR 459 CG42678-PR 148..260 30..147 212 33.9 Plus
ReepA-PQ 685 CG42678-PQ 148..260 30..147 212 33.9 Plus
ReepA-PI 716 CG42678-PI 148..260 30..147 212 33.9 Plus
ReepA-PG 288 CG30193-PG 7..113 40..147 211 32.4 Plus
ReepA-PE 288 CG30193-PE 7..113 40..147 211 32.4 Plus
ReepA-PS 312 CG42678-PS 7..113 40..147 211 32.4 Plus
ReepA-PP 538 CG42678-PP 7..113 40..147 211 32.4 Plus
ReepA-PH 569 CG42678-PH 7..113 40..147 211 32.4 Plus
ReepA-PJ 570 CG42678-PJ 7..113 40..147 211 32.4 Plus
Reepl1-PA 240 CG11697-PA 1..107 34..141 154 30 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19086-PA 181 GI19086-PA 43..181 17..155 589 78.4 Plus
Dmoj\GI21304-PA 281 GI21304-PA 7..114 40..148 193 30.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17205-PA 181 GL17205-PA 50..181 24..155 642 87.9 Plus
Dper\GL11033-PA 288 GL11033-PA 3..114 35..147 147 25.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20994-PA 181 GA20994-PA 50..181 24..155 642 87.9 Plus
Dpse\GA30269-PA 550 GA30269-PA 7..114 40..148 214 32.1 Plus
Dpse\GA30269-PG 693 GA30269-PG 122..257 20..148 212 29.9 Plus
Dpse\GA30269-PB 250 GA30269-PB 7..114 40..148 200 32.1 Plus
Dpse\GA30269-PC 393 GA30269-PC 122..257 20..148 197 27.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21516-PA 181 GM21516-PA 51..181 25..155 696 99.2 Plus
Dsec\GM10217-PA 177 GM10217-PA 33..158 4..132 495 72.9 Plus
Dsec\GM15973-PA 288 GM15973-PA 7..114 40..148 204 32.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11027-PA 181 GD11027-PA 51..181 25..155 696 99.2 Plus
Dsim\GD18168-PA 177 GD18168-PA 33..158 4..132 495 72.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20059-PA 181 GJ20059-PA 51..181 25..155 618 84.7 Plus
Dvir\GJ21570-PA 284 GJ21570-PA 7..113 40..147 194 30.6 Plus
Dvir\GJ15630-PA 320 GJ15630-PA 4..114 41..153 154 27.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21552-PA 181 GK21552-PA 50..181 24..155 624 87.1 Plus
Dwil\GK19544-PA 281 GK19544-PA 7..114 40..148 193 30.3 Plus
Dwil\GK19241-PA 267 GK19241-PA 14..129 46..152 155 30.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13560-PA 181 GE13560-PA 43..181 17..155 676 91.4 Plus
Dyak\GE10663-PA 175 GE10663-PA 51..170 25..144 566 85.8 Plus
Dyak\GE14249-PA 286 GE14249-PA 7..114 40..148 205 32.1 Plus
Dyak\GE15946-PA 241 GE15946-PA 1..108 34..141 162 30.9 Plus