BDGP Sequence Production Resources |
Search the DGRC for MIP06274
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 62 |
Well: | 74 |
Vector: | pOT2|pOTB7_DraIII |
Associated Gene/Transcript | CG8331-RC |
Protein status: | MIP06274.pep: gold |
Sequenced Size: | 678 |
678 bp assembled on 2009-02-24
GenBank Submission: BT070223.1
> MIP06274.complete GGCGAACATGGCAGTCGAGGAATTAGAGAGCAAAATTGTCCAACTGTTCG TAGAGAACCCCCTCCTGCGCTACGGTGCTGTTGGTCTGTGCGCCATCTAC CTGATCTTTGGCTGGGGCGCCCAACTACTGTGCAACATCATTGGGGTTCT GTACCCTGCATATATTTCCATCCATGCCATCGAGTCCAGCACAAAGCAGG ACGACACCAAGTGGCTGATCTACTGGGTCACGTTTGGAATCTTCACCGTG ATTGAATTCTTTTCGAGTCTGCTAACTTCGGTGATTCCCTTTTACTGGCT GCTGAAGTGTGCTTTCCTCATCTGGTGCATGCTGCCCACGGAACAGAATG GTTCTACCATCATCTACAACAAGCTGGTGCGACCCTACTTCCTGAAACAT CACGAATCCGTTGACAGGATCATCGATGATGGCATGAAGAAAGCCGCTGG AGTGCTGAAGCATGACTAGAAGGCGAATGTACCGTAGCTCCGACCGCTTC TCGCTTATCCATGCATTTGGTTTTGGGCCTGGTCACCAACCTCACCTCGT ATTGGTTACGTTTTGCAATAAATTTTAATTCTGTATTCATTTTGTTGTTG ATAAGAGCACCAGTGTTCGCTGAACCAGAAGAAATCTCCGTTTGTTAAAC GTAAAAACGAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 10060056..10060307 | 408..659 | 1260 | 100 | Plus |
chr2R | 21145070 | chr2R | 10059598..10059831 | 74..307 | 1170 | 100 | Plus |
chr3R | 27901430 | chr3R | 21609728..21610059 | 420..89 | 1105 | 88.9 | Minus |
chr2R | 21145070 | chr2R | 10059891..10059992 | 306..407 | 510 | 100 | Plus |
chr2R | 21145070 | chr2R | 10059462..10059537 | 1..76 | 380 | 100 | Plus |
chr3R | 27901430 | chr3R | 21609531..21609680 | 657..508 | 345 | 82 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 14172747..14173002 | 408..663 | 1280 | 100 | Plus |
2R | 25286936 | 2R | 14172289..14172522 | 74..307 | 1170 | 100 | Plus |
3R | 32079331 | 3R | 25786726..25787057 | 420..89 | 1090 | 88.6 | Minus |
2R | 25286936 | 2R | 14172582..14172683 | 306..407 | 510 | 100 | Plus |
2R | 25286936 | 2R | 14172153..14172228 | 1..76 | 380 | 100 | Plus |
3R | 32079331 | 3R | 25786524..25786678 | 662..508 | 355 | 81.9 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 14173946..14174201 | 408..663 | 1280 | 100 | Plus |
2R | 25260384 | 2R | 14173488..14173721 | 74..307 | 1170 | 100 | Plus |
3R | 31820162 | 3R | 25527557..25527888 | 420..89 | 1090 | 88.5 | Minus |
2R | 25260384 | 2R | 14173781..14173882 | 306..407 | 510 | 100 | Plus |
2R | 25260384 | 2R | 14173352..14173427 | 1..76 | 380 | 100 | Plus |
3R | 31820162 | 3R | 25527355..25527509 | 662..508 | 355 | 81.9 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
HeT-A | 6083 | HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). | 5241..5263 | 570..592 | 106 | 95.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 10059462..10059535 | 1..74 | 100 | -> | Plus |
chr2R | 10059599..10059831 | 75..307 | 100 | -> | Plus |
chr2R | 10059893..10059992 | 308..407 | 100 | -> | Plus |
chr2R | 10060056..10060307 | 408..659 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8331-RA | 138..537 | 68..469 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8331-RC | 1..462 | 8..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8331-RC | 1..462 | 8..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8331-RC | 1..462 | 8..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8331-RA | 253..765 | 68..582 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8331-RC | 1..659 | 1..659 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8331-RC | 365..1023 | 1..659 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8331-RC | 365..1023 | 1..659 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14172584..14172683 | 308..407 | 100 | -> | Plus |
2R | 14172747..14172998 | 408..659 | 100 | Plus | |
2R | 14172153..14172226 | 1..74 | 100 | -> | Plus |
2R | 14172290..14172522 | 75..307 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14172584..14172683 | 308..407 | 100 | -> | Plus |
2R | 14172747..14172998 | 408..659 | 100 | Plus | |
2R | 14172153..14172226 | 1..74 | 100 | -> | Plus |
2R | 14172290..14172522 | 75..307 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14172584..14172683 | 308..407 | 100 | -> | Plus |
2R | 14172747..14172998 | 408..659 | 100 | Plus | |
2R | 14172153..14172226 | 1..74 | 100 | -> | Plus |
2R | 14172290..14172522 | 75..307 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 10059658..10059731 | 1..74 | 100 | -> | Plus |
arm_2R | 10059795..10060027 | 75..307 | 100 | -> | Plus |
arm_2R | 10060089..10060188 | 308..407 | 100 | -> | Plus |
arm_2R | 10060252..10060503 | 408..659 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14173489..14173721 | 75..307 | 100 | -> | Plus |
2R | 14173783..14173882 | 308..407 | 100 | -> | Plus |
2R | 14173946..14174197 | 408..659 | 100 | Plus | |
2R | 14173352..14173425 | 1..74 | 100 | -> | Plus |
Translation from 0 to 468
> MIP06274.hyp ANMAVEELESKIVQLFVENPLLRYGAVGLCAIYLIFGWGAQLLCNIIGVL YPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWL LKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKKAAG VLKHD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG8331-PC | 153 | CG8331-PC | 1..153 | 3..155 | 812 | 100 | Plus |
CG8331-PB | 160 | CG8331-PB | 27..160 | 22..155 | 707 | 98.5 | Plus |
CG8331-PD | 178 | CG8331-PD | 48..178 | 25..155 | 706 | 100 | Plus |
CG8331-PA | 178 | CG8331-PA | 48..178 | 25..155 | 706 | 100 | Plus |
CG4960-PB | 174 | CG4960-PB | 33..174 | 4..155 | 536 | 69.1 | Plus |
Translation from 1 to 468
> MIP06274.pep ANMAVEELESKIVQLFVENPLLRYGAVGLCAIYLIFGWGAQLLCNIIGVL YPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWL LKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKKAAG VLKHD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12032-PA | 181 | GF12032-PA | 51..181 | 25..155 | 650 | 92.4 | Plus |
Dana\GF13556-PA | 290 | GF13556-PA | 7..114 | 40..148 | 204 | 32.1 | Plus |
Dana\GF20320-PA | 267 | GF20320-PA | 1..109 | 34..141 | 166 | 30 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20429-PA | 181 | GG20429-PA | 51..181 | 25..155 | 656 | 92.4 | Plus |
Dere\GG12216-PA | 164 | GG12216-PA | 51..164 | 25..138 | 557 | 88.6 | Plus |
Dere\GG22816-PA | 285 | GG22816-PA | 7..114 | 40..148 | 205 | 32.1 | Plus |
Dere\GG18428-PA | 244 | GG18428-PA | 1..108 | 34..141 | 163 | 30 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21843-PA | 181 | GH21843-PA | 43..181 | 17..155 | 591 | 77.7 | Plus |
Dgri\GH20967-PA | 281 | GH20967-PA | 7..114 | 40..148 | 194 | 30.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ReepB-PC | 153 | CG8331-PC | 1..153 | 3..155 | 812 | 100 | Plus |
ReepB-PB | 160 | CG8331-PB | 27..160 | 22..155 | 707 | 98.5 | Plus |
ReepB-PD | 178 | CG8331-PD | 48..178 | 25..155 | 706 | 100 | Plus |
ReepB-PA | 178 | CG8331-PA | 48..178 | 25..155 | 706 | 100 | Plus |
CG4960-PB | 174 | CG4960-PB | 33..174 | 4..155 | 536 | 69.1 | Plus |
CG4960-PA | 174 | CG4960-PA | 33..174 | 4..155 | 536 | 69.1 | Plus |
ReepA-PO | 291 | CG42678-PO | 148..260 | 30..147 | 212 | 33.9 | Plus |
ReepA-PD | 435 | CG30193-PD | 148..260 | 30..147 | 212 | 33.9 | Plus |
ReepA-PR | 459 | CG42678-PR | 148..260 | 30..147 | 212 | 33.9 | Plus |
ReepA-PQ | 685 | CG42678-PQ | 148..260 | 30..147 | 212 | 33.9 | Plus |
ReepA-PI | 716 | CG42678-PI | 148..260 | 30..147 | 212 | 33.9 | Plus |
ReepA-PG | 288 | CG30193-PG | 7..113 | 40..147 | 211 | 32.4 | Plus |
ReepA-PE | 288 | CG30193-PE | 7..113 | 40..147 | 211 | 32.4 | Plus |
ReepA-PS | 312 | CG42678-PS | 7..113 | 40..147 | 211 | 32.4 | Plus |
ReepA-PP | 538 | CG42678-PP | 7..113 | 40..147 | 211 | 32.4 | Plus |
ReepA-PH | 569 | CG42678-PH | 7..113 | 40..147 | 211 | 32.4 | Plus |
ReepA-PJ | 570 | CG42678-PJ | 7..113 | 40..147 | 211 | 32.4 | Plus |
Reepl1-PA | 240 | CG11697-PA | 1..107 | 34..141 | 154 | 30 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19086-PA | 181 | GI19086-PA | 43..181 | 17..155 | 589 | 78.4 | Plus |
Dmoj\GI21304-PA | 281 | GI21304-PA | 7..114 | 40..148 | 193 | 30.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17205-PA | 181 | GL17205-PA | 50..181 | 24..155 | 642 | 87.9 | Plus |
Dper\GL11033-PA | 288 | GL11033-PA | 3..114 | 35..147 | 147 | 25.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20994-PA | 181 | GA20994-PA | 50..181 | 24..155 | 642 | 87.9 | Plus |
Dpse\GA30269-PA | 550 | GA30269-PA | 7..114 | 40..148 | 214 | 32.1 | Plus |
Dpse\GA30269-PG | 693 | GA30269-PG | 122..257 | 20..148 | 212 | 29.9 | Plus |
Dpse\GA30269-PB | 250 | GA30269-PB | 7..114 | 40..148 | 200 | 32.1 | Plus |
Dpse\GA30269-PC | 393 | GA30269-PC | 122..257 | 20..148 | 197 | 27.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21516-PA | 181 | GM21516-PA | 51..181 | 25..155 | 696 | 99.2 | Plus |
Dsec\GM10217-PA | 177 | GM10217-PA | 33..158 | 4..132 | 495 | 72.9 | Plus |
Dsec\GM15973-PA | 288 | GM15973-PA | 7..114 | 40..148 | 204 | 32.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11027-PA | 181 | GD11027-PA | 51..181 | 25..155 | 696 | 99.2 | Plus |
Dsim\GD18168-PA | 177 | GD18168-PA | 33..158 | 4..132 | 495 | 72.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20059-PA | 181 | GJ20059-PA | 51..181 | 25..155 | 618 | 84.7 | Plus |
Dvir\GJ21570-PA | 284 | GJ21570-PA | 7..113 | 40..147 | 194 | 30.6 | Plus |
Dvir\GJ15630-PA | 320 | GJ15630-PA | 4..114 | 41..153 | 154 | 27.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21552-PA | 181 | GK21552-PA | 50..181 | 24..155 | 624 | 87.1 | Plus |
Dwil\GK19544-PA | 281 | GK19544-PA | 7..114 | 40..148 | 193 | 30.3 | Plus |
Dwil\GK19241-PA | 267 | GK19241-PA | 14..129 | 46..152 | 155 | 30.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13560-PA | 181 | GE13560-PA | 43..181 | 17..155 | 676 | 91.4 | Plus |
Dyak\GE10663-PA | 175 | GE10663-PA | 51..170 | 25..144 | 566 | 85.8 | Plus |
Dyak\GE14249-PA | 286 | GE14249-PA | 7..114 | 40..148 | 205 | 32.1 | Plus |
Dyak\GE15946-PA | 241 | GE15946-PA | 1..108 | 34..141 | 162 | 30.9 | Plus |