Clone MIP06286 Report

Search the DGRC for MIP06286

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:62
Well:86
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43093-RA
Protein status:MIP06286.pep: gold
Sequenced Size:493

Clone Sequence Records

MIP06286.complete Sequence

493 bp assembled on 2009-04-03

GenBank Submission: BT081964.1

> MIP06286.complete
AAAATGCAGCTGAGTATTATAGTATTGCTCTTGTGCTCGGTGGTTGTTGC
AAATTCACTTGCCCCAAGTCAACTGGCATCGAAAACCCCATCACCCAATG
TAAGCAAGGATCAGCCGTCATCCAGGGAGGAGAAACCCAGTTTGAAACCG
TGCAAACCCATCGAGACTGTGAGTTCAGAGCCAAAAGGACTAGGCAATAC
TCCTAAAGTCGGTTCAATTACTCCGGAATCAGCTAAAACGTCTGGCACAA
CCGTGGATAAAAGTCTGGATGATTGCGAACCCATTCCCGAGGGTATTGGA
TCTCGATTGAATGCGAGAACTCTTCAAACACTGGTTATAAAAAATAATAA
TAACCCTCTTTTTAATTGAGTAAAACATGAAAATCATTAAATAACATTTA
TGTAAGCTTACTTCAATAATAAATTAGTACAAAGAAAATCGTAAATCATA
CCAAGAAAACTTCTAAGTGATTGATTAAAAAAAAAAAAAAAAA

MIP06286.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
nc_18466.a 1230 nc_18466.a 1..403 76..478 2015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18593267..18593727 476..16 2275 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22769773..22770235 478..16 2315 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22510604..22511066 478..16 2315 100 Minus
Blast to na_te.dros performed 2019-03-16 17:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy5 7369 gypsy5 GYPSY5 7369bp 5929..6033 316..424 130 60.6 Plus
Burdock 6411 Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). 499..538 367..329 116 80 Minus
accord2 7650 accord2 QBERT 7650bp 6154..6291 473..343 115 57.2 Minus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 22..107 327..410 110 60.5 Plus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 7060..7145 327..410 110 60.5 Plus

MIP06286.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:33:45 Download gff for MIP06286.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18593267..18593727 16..476 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:26 Download gff for MIP06286.complete
Subject Subject Range Query Range Percent Splice Strand
CG43093-RA 1..366 4..369 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:12 Download gff for MIP06286.complete
Subject Subject Range Query Range Percent Splice Strand
CG43093-RA 1..366 4..369 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:01:14 Download gff for MIP06286.complete
Subject Subject Range Query Range Percent Splice Strand
CG43093-RA 1..366 4..369 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:26 Download gff for MIP06286.complete
Subject Subject Range Query Range Percent Splice Strand
CG43093-RA 1..476 1..476 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:12 Download gff for MIP06286.complete
Subject Subject Range Query Range Percent Splice Strand
CG43093-RA 1..476 1..476 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:01:14 Download gff for MIP06286.complete
Subject Subject Range Query Range Percent Splice Strand
CG43093-RA 1..476 1..476 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:45 Download gff for MIP06286.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22769775..22770235 16..476 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:45 Download gff for MIP06286.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22769775..22770235 16..476 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:45 Download gff for MIP06286.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22769775..22770235 16..476 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:12 Download gff for MIP06286.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18595497..18595957 16..476 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:25 Download gff for MIP06286.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22510606..22511066 16..476 100 <- Minus

MIP06286.pep Sequence

Translation from 0 to 368

> MIP06286.pep
KMQLSIIVLLLCSVVVANSLAPSQLASKTPSPNVSKDQPSSREEKPSLKP
CKPIETVSSEPKGLGNTPKVGSITPESAKTSGTTVDKSLDDCEPIPEGIG
SRLNARTLQTLVIKNNNNPLFN*

MIP06286.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG43093-PA 121 CG43093-PA 1..121 2..122 612 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23609-PA 78 GM23609-PA 5..58 6..59 231 87 Plus

MIP06286.hyp Sequence

Translation from 0 to 368

> MIP06286.hyp
KMQLSIIVLLLCSVVVANSLAPSQLASKTPSPNVSKDQPSSREEKPSLKP
CKPIETVSSEPKGLGNTPKVGSITPESAKTSGTTVDKSLDDCEPIPEGIG
SRLNARTLQTLVIKNNNNPLFN*

MIP06286.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG43093-PA 121 CG43093-PA 1..121 2..122 612 100 Plus