MIP06286.complete Sequence
493 bp assembled on 2009-04-03
GenBank Submission: BT081964.1
> MIP06286.complete
AAAATGCAGCTGAGTATTATAGTATTGCTCTTGTGCTCGGTGGTTGTTGC
AAATTCACTTGCCCCAAGTCAACTGGCATCGAAAACCCCATCACCCAATG
TAAGCAAGGATCAGCCGTCATCCAGGGAGGAGAAACCCAGTTTGAAACCG
TGCAAACCCATCGAGACTGTGAGTTCAGAGCCAAAAGGACTAGGCAATAC
TCCTAAAGTCGGTTCAATTACTCCGGAATCAGCTAAAACGTCTGGCACAA
CCGTGGATAAAAGTCTGGATGATTGCGAACCCATTCCCGAGGGTATTGGA
TCTCGATTGAATGCGAGAACTCTTCAAACACTGGTTATAAAAAATAATAA
TAACCCTCTTTTTAATTGAGTAAAACATGAAAATCATTAAATAACATTTA
TGTAAGCTTACTTCAATAATAAATTAGTACAAAGAAAATCGTAAATCATA
CCAAGAAAACTTCTAAGTGATTGATTAAAAAAAAAAAAAAAAA
MIP06286.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:29:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
nc_18466.a | 1230 | nc_18466.a | 1..403 | 76..478 | 2015 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:32:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 18593267..18593727 | 476..16 | 2275 | 99.6 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:32:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 22769773..22770235 | 478..16 | 2315 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 22510604..22511066 | 478..16 | 2315 | 100 | Minus |
Blast to na_te.dros performed 2019-03-16 17:32:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy5 | 7369 | gypsy5 GYPSY5 7369bp | 5929..6033 | 316..424 | 130 | 60.6 | Plus |
Burdock | 6411 | Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). | 499..538 | 367..329 | 116 | 80 | Minus |
accord2 | 7650 | accord2 QBERT 7650bp | 6154..6291 | 473..343 | 115 | 57.2 | Minus |
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 22..107 | 327..410 | 110 | 60.5 | Plus |
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 7060..7145 | 327..410 | 110 | 60.5 | Plus |
MIP06286.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:33:45 Download gff for
MIP06286.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 18593267..18593727 | 16..476 | 99 | <- | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:26 Download gff for
MIP06286.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43093-RA | 1..366 | 4..369 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:12 Download gff for
MIP06286.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43093-RA | 1..366 | 4..369 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:01:14 Download gff for
MIP06286.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43093-RA | 1..366 | 4..369 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:26 Download gff for
MIP06286.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43093-RA | 1..476 | 1..476 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:12 Download gff for
MIP06286.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43093-RA | 1..476 | 1..476 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:01:14 Download gff for
MIP06286.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43093-RA | 1..476 | 1..476 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:45 Download gff for
MIP06286.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22769775..22770235 | 16..476 | 100 | <- | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:45 Download gff for
MIP06286.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22769775..22770235 | 16..476 | 100 | <- | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:45 Download gff for
MIP06286.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22769775..22770235 | 16..476 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:12 Download gff for
MIP06286.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 18595497..18595957 | 16..476 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:25 Download gff for
MIP06286.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22510606..22511066 | 16..476 | 100 | <- | Minus |
MIP06286.pep Sequence
Translation from 0 to 368
> MIP06286.pep
KMQLSIIVLLLCSVVVANSLAPSQLASKTPSPNVSKDQPSSREEKPSLKP
CKPIETVSSEPKGLGNTPKVGSITPESAKTSGTTVDKSLDDCEPIPEGIG
SRLNARTLQTLVIKNNNNPLFN*
MIP06286.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43093-PA | 121 | CG43093-PA | 1..121 | 2..122 | 612 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:59:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23609-PA | 78 | GM23609-PA | 5..58 | 6..59 | 231 | 87 | Plus |
MIP06286.hyp Sequence
Translation from 0 to 368
> MIP06286.hyp
KMQLSIIVLLLCSVVVANSLAPSQLASKTPSPNVSKDQPSSREEKPSLKP
CKPIETVSSEPKGLGNTPKVGSITPESAKTSGTTVDKSLDDCEPIPEGIG
SRLNARTLQTLVIKNNNNPLFN*
MIP06286.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43093-PA | 121 | CG43093-PA | 1..121 | 2..122 | 612 | 100 | Plus |