Clone MIP06305 Report

Search the DGRC for MIP06305

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:63
Well:5
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42463-RB
Protein status:MIP06305.pep: gold
Sequenced Size:405

Clone Sequence Records

MIP06305.complete Sequence

405 bp assembled on 2009-02-20

GenBank Submission: BT064659.1

> MIP06305.complete
AAGCAACACTTGAAATGAAATTACTCTCTGCGGTTCTTCTAATAGGTACC
TTAAGTGCCATTTGTCTTGGCCAAAAGGAACCCATATGCAGGTCTGATCC
GAGTGTTGTCGGAAATTGTGGGCATAAAATTAAAGGGTATACCTATGAAG
TTCGAAAAAATAATTGCAAGAAGTTCCGGGCGATGGCCTGTAAGGTAACT
GGAAACTTTTTCCGTAGCAGGGATGCGTGCAATGCGAAGTGCAAGGACAC
CAGGAAGCCAGCTCAAAGCGGAGTCATTGAATTCTTCAGTCGAACGGTGT
CGCAGTTTCTGCAGATGATCTTAAGCCTAATGAGTTGGGCCGGATTTTGA
ACCAATAAACTATATTGATAATAGTAAAAATCTTAAAAAAAAAAAAAAAA
AAAAA

MIP06305.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG42463-RB 469 CG42463-RB 43..427 1..385 1925 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3668196..3668498 384..82 1485 99.3 Minus
chr2L 23010047 chr2L 3668559..3668639 81..1 405 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3668690..3668993 385..82 1520 100 Minus
2L 23513712 2L 3669054..3669134 81..1 405 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3668690..3668993 385..82 1520 100 Minus
2L 23513712 2L 3669054..3669134 81..1 405 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:28:21 has no hits.

MIP06305.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:29:04 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3668196..3668498 82..384 99 <- Minus
chr2L 3668559..3668639 1..81 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:11 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
CG42463-RA 1..342 15..350 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:36:41 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
CG42463-RB 1..336 15..350 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:01:49 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
CG42463-RB 1..336 15..350 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:10:34 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
CG42463-RB 1..336 15..350 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-20 22:04:10 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
CG42463-RA 1..342 15..350 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:36:41 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
CG42463-RB 1..384 1..384 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:01:49 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
CG42463-RB 1..384 1..384 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:10:34 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
CG42463-RB 1..384 1..384 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:29:04 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3668691..3668993 82..384 100 <- Minus
2L 3669054..3669134 1..81 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:29:04 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3668691..3668993 82..384 100 <- Minus
2L 3669054..3669134 1..81 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:29:04 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3668691..3668993 82..384 100 <- Minus
2L 3669054..3669134 1..81 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:01:49 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3668691..3668993 82..384 100 <- Minus
arm_2L 3669054..3669134 1..81 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:18 Download gff for MIP06305.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3668691..3668993 82..384 100 <- Minus
2L 3669054..3669134 1..81 100   Minus

MIP06305.pep Sequence

Translation from 2 to 349

> MIP06305.pep
ATLEMKLLSAVLLIGTLSAICLGQKEPICRSDPSVVGNCGHKIKGYTYEV
RKNNCKKFRAMACKVTGNFFRSRDACNAKCKDTRKPAQSGVIEFFSRTVS
QFLQMILSLMSWAGF*

MIP06305.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14658-PA 110 GF14658-PA 1..104 5..108 213 40.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24Bd-PB 111 CG42463-PB 1..111 5..115 585 100 Plus
Sfp24Bc-PA 100 CG42602-PA 5..78 11..82 180 43.2 Plus
Sfp24Ba-PA 121 CG42461-PA 6..75 12..81 174 45.7 Plus
Sfp24Bb-PA 110 CG42462-PA 7..97 17..101 148 35.2 Plus
IM33-PB 82 CG16712-PB 1..82 5..82 133 35.4 Plus
IM33-PA 82 CG16712-PA 1..82 5..82 133 35.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22739-PA 111 GD22739-PA 7..111 17..115 451 82.9 Plus

MIP06305.hyp Sequence

Translation from 2 to 349

> MIP06305.hyp
ATLEMKLLSAVLLIGTLSAICLGQKEPICRSDPSVVGNCGHKIKGYTYEV
RKNNCKKFRAMACKVTGNFFRSRDACNAKCKDTRKPAQSGVIEFFSRTVS
QFLQMILSLMSWAGF*

MIP06305.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42463-PB 111 CG42463-PB 1..111 5..115 585 100 Plus
Sfp24Bc-PA 100 CG42602-PA 5..78 11..82 180 43.2 Plus
Sfp24Ba-PA 121 CG42461-PA 6..75 12..81 174 45.7 Plus
Sfp24Bb-PA 110 CG42462-PA 7..97 17..101 148 35.2 Plus
CG16712-PB 82 CG16712-PB 1..82 5..82 133 35.4 Plus