Clone MIP06327 Report

Search the DGRC for MIP06327

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:63
Well:27
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptPde8-RF
Protein status:MIP06327.pep: wuzgold
Sequenced Size:1248

Clone Sequence Records

MIP06327.complete Sequence

1248 bp assembled on 2009-02-21

GenBank Submission: BT066319.1

> MIP06327.complete
AACCGTCGTCGATCGGGGATCGTGAATAGCGGACTGCGGACAGCGGATTG
CGGATTGCGGATCGCGACGCGGATAGCGGCTGAATCTCGTGAATCGGAAT
CTTGGGCGTCTTCTCTCCCCTCCTCCACTCCTCTCGCCGCCGGCCGCACC
GAGCAGAGTTCTGAATTCTAGTCTAGAGTCTGATATAAATATTAAAATAA
GTATAAGAAGCGGCGCACAGCTACGTCTGCCCGCCTATGTGCATAAAATA
TCACAAGCAACAGGCGGCCAAGCAACAACTACCAGCTGAACGACAAATTT
TTGGTTTCGTTATCCGGATCATGTGACCAGTATCTCCGCTGGCCATCAGT
CAATCAATCAGCAGACCGCAGCCCAAAAATGTTTCAATTATGTTATCGCC
AGCAACAACGACATCGTCCAGAATCGAAAGCATCGAACCAGAGCAGCAGC
AACCACAAGAAGGCAGCCGCACTGTCCAGGACGAAGGAGTAAGACGTGCA
ATTCCGCAAAGGCTAAATCCGGATACGGAACCGGAGCCCACTGCAAAACC
GAAATCACAAGGCAACCAAGAGCAATTTAGCATAGCAACCGCAACGCAAT
CAGCCAGGCCAGGATCAGAAGCAGGACTTCTTAGCCATGGGCTGTTCTCC
GAGTACTTTGCCCCCCGCCCCTTCCGCTGGTCAGACCGGCGAACGAGGAT
CCCTGCCGCTGGACGCCTCTGAAAAGGACGAGAGCCGCCTCTTCTGCATC
AAGCTGCGGCGCAGCCGCCTGCGCCGCTGCAGCTGTGGGGGCGTGACCTT
GCAGCCCCCCAGCGACGGGAATGGCAGCACGGCCGGAGACAACCTGTGCG
GCCAGGTGCTCCTCAATCCGCTGCAGACCAAGAGCGAGGCCGACTACGAA
AAGCTGAGCACCGGCAAAAAGGACTCGATTGTGACGGTGGCCGCCCTGGG
CAACTTTACACACAGCGTAGTGCGACGGGCCACTGGAAGTAAGTAGAGCA
AGTAACTAACGCTAAGATTTGCTCCAAGTAGTAACCCGATATGGAAGTGC
CAACATCCTTTCATGCGCCGAAATAATCCACCGCCTTGGTTCTCAAGAAG
GAAGCAGAAATAGTTTGGAAAGAATTTTTAAAAAGTTTGAATAATTTATT
CGTGGCCATTTGAAAATTGCTTGTGTCTTTGATGGTTAGGTTGCATTTTT
GTTAAATCGATTAAATGGAGCTTGATATTTAAAAAAAAAAAAAAAAAA

MIP06327.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
Pde8-RF 1379 Pde8-RF 71..1304 1..1233 6130 99.9 Plus
Pde8.e 5786 Pde8.e 249..1238 1..989 4910 99.8 Plus
Pde8.j 6375 Pde8.j 1005..1824 170..989 4100 100 Plus
Pde8.j 6375 Pde8.j 141..310 1..169 810 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19551487..19552081 309..903 2975 100 Plus
chr2R 21145070 chr2R 19552143..19552471 902..1230 1585 98.8 Plus
chr2R 21145070 chr2R 19546606..19546745 170..309 700 100 Plus
chr2R 21145070 chr2R 19545740..19545900 1..169 595 94.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23665293..23665887 309..903 2975 100 Plus
2R 25286936 2R 23665949..23666280 902..1233 1660 100 Plus
2R 25286936 2R 23659530..23659699 1..169 800 99.4 Plus
2R 25286936 2R 23660394..23660533 170..309 700 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23666492..23667086 309..903 2975 100 Plus
2R 25260384 2R 23667148..23667479 902..1233 1660 100 Plus
2R 25260384 2R 23660729..23660898 1..169 810 99.4 Plus
2R 25260384 2R 23661593..23661732 170..309 700 100 Plus
Blast to na_te.dros performed 2019-03-15 23:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6788..6871 400..485 136 68.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2376..2537 400..564 123 57.7 Plus
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 2149..2217 727..796 113 64.3 Plus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 1529..1562 1102..1134 113 85.3 Plus

MIP06327.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:18:51 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19545740..19545900 1..169 94 -> Plus
chr2R 19546606..19546745 170..309 100 -> Plus
chr2R 19551488..19552081 310..903 100 -> Plus
chr2R 19552145..19552471 904..1230 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:24 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
Pde8-RA 1..353 637..989 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:18 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
Pde8-RF 1..360 637..996 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:37:03 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
Pde8-RN 1..353 637..989 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:02 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
Pde8-RN 1..353 637..989 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-21 17:15:18 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
Pde8-RE 44..869 163..989 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:18 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
Pde8-RF 1..1231 1..1230 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:37:03 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
Pde8-RI 26..1015 1..989 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:02 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
Pde8-RI 26..1015 1..989 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:51 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23659530..23659699 1..169 99 -> Plus
2R 23660394..23660533 170..309 100 -> Plus
2R 23665294..23665887 310..903 100 -> Plus
2R 23665951..23666277 904..1230 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:51 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23659530..23659699 1..169 99 -> Plus
2R 23660394..23660533 170..309 100 -> Plus
2R 23665294..23665887 310..903 100 -> Plus
2R 23665951..23666277 904..1230 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:51 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23659530..23659699 1..169 99 -> Plus
2R 23660394..23660533 170..309 100 -> Plus
2R 23665294..23665887 310..903 100 -> Plus
2R 23665951..23666277 904..1230 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:37:03 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19547053..19547222 1..169 99 -> Plus
arm_2R 19547917..19548056 170..309 100 -> Plus
arm_2R 19552817..19553410 310..903 100 -> Plus
arm_2R 19553474..19553800 904..1230 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:03 Download gff for MIP06327.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23666511..23667104 310..903 100 -> Plus
2R 23667168..23667494 904..1230 100   Plus
2R 23660747..23660916 1..169 99 -> Plus
2R 23661611..23661750 170..309 100 -> Plus

MIP06327.pep Sequence

Translation from 636 to 995

> MIP06327.pep
MGCSPSTLPPAPSAGQTGERGSLPLDASEKDESRLFCIKLRRSRLRRCSC
GGVTLQPPSDGNGSTAGDNLCGQVLLNPLQTKSEADYEKLSTGKKDSIVT
VAALGNFTHSVVRRATGSK*

MIP06327.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13070-PA 926 GF13070-PA 1..126 1..115 414 82.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22873-PA 905 GG22873-PA 1..118 1..118 629 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20665-PA 921 GH20665-PA 1..128 1..115 379 65.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
Pde8-PE 905 CG45019-PE 1..118 1..118 612 100 Plus
Pde8-PK 914 CG45019-PK 1..118 1..118 612 100 Plus
Pde8-PI 914 CG45019-PI 1..118 1..118 612 100 Plus
Pde8-PA 914 CG45019-PA 1..118 1..118 612 100 Plus
Pde8-PN 949 CG45019-PN 1..118 1..118 612 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19028-PA 952 GI19028-PA 1..123 1..114 315 69.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16875-PA 1333 GL16875-PA 1..137 1..117 346 68.1 Plus
Dper\GL14120-PA 151 GL14120-PA 43..138 33..118 290 79.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18863-PB 928 GA18863-PB 1..134 1..115 345 67.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16033-PA 914 GM16033-PA 1..118 1..118 627 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19994-PA 956 GJ19994-PA 1..123 1..112 294 67.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23066-PA 924 GK23066-PA 1..122 1..115 342 77 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14311-PA 906 GE14311-PA 1..119 1..118 616 99.2 Plus

MIP06327.hyp Sequence

Translation from 636 to 995

> MIP06327.hyp
MGCSPSTLPPAPSAGQTGERGSLPLDASEKDESRLFCIKLRRSRLRRCSC
GGVTLQPPSDGNGSTAGDNLCGQVLLNPLQTKSEADYEKLSTGKKDSIVT
VAALGNFTHSVVRRATGSK*

MIP06327.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Pde8-PE 905 CG45019-PE 1..118 1..118 612 100 Plus
Pde8-PK 914 CG45019-PK 1..118 1..118 612 100 Plus
Pde8-PI 914 CG45019-PI 1..118 1..118 612 100 Plus
Pde8-PA 914 CG45019-PA 1..118 1..118 612 100 Plus
Pde8-PN 949 CG45019-PN 1..118 1..118 612 100 Plus