Clone MIP06329 Report

Search the DGRC for MIP06329

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:63
Well:29
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43405-RA
Protein status:MIP06329.pep: wuzgold
Sequenced Size:440

Clone Sequence Records

MIP06329.complete Sequence

440 bp assembled on 2009-02-20

GenBank Submission: BT064661.1

> MIP06329.complete
CGAAATTCTTAAGCTGCTATGCAAGGAACGAGGGTTCAATCTATTATCGA
AAGCAACAAAATTTGCAATTTATTTCCCATAAGCTATGGCCGAGTTGGAT
GCTACAACCCTATCTGAATACGATATTGAATATATAGACTTTAACATGAC
AACTGTGGCGTACCGTACAACCACTGGACACCCGGATACTAACCTAGGTG
CTTGGGGACTTTTGTTCATATTCGTCGTAATTTTTCTTATCATTGCTGCC
TGCTGTGCTTGTATGGGTGTTCTCGTCCTTTTTGGTTGTATGAAGTCCTT
TCTCTGTTTTCGCTGTAGACGCCGAGGCGACGAGTTTATAGGAAGGGAAC
CCTGACTGTCGTTGAAATTCTGTCATTAAAACTGAAACTTGTGCTAATAA
AATTATATGTTTTGTATGAATCGAAAAAAAAAAAAAAAAA

MIP06329.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
nc_8507.a 423 nc_8507.a 1..423 1..423 2115 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17839958..17840351 423..30 1955 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21953613..21954008 425..30 1980 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21954812..21955207 425..30 1980 100 Minus
2R 25260384 2R 21955265..21955294 30..1 150 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:49:33 has no hits.

MIP06329.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:50:37 Download gff for MIP06329.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17839958..17840350 31..423 99 <- Minus
chr2R 17840409..17840438 1..30 100   Minus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:24:11 Download gff for MIP06329.complete
Subject Subject Range Query Range Percent Splice Strand
CG43405-RA 1..270 86..355 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:24:11 Download gff for MIP06329.complete
Subject Subject Range Query Range Percent Splice Strand
CG43405-RA 1..423 1..423 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:37 Download gff for MIP06329.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21953615..21954007 31..423 100 <- Minus
2R 21954066..21954095 1..30 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:37 Download gff for MIP06329.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21953615..21954007 31..423 100 <- Minus
2R 21954066..21954095 1..30 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:37 Download gff for MIP06329.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21953615..21954007 31..423 100 <- Minus
2R 21954066..21954095 1..30 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:24:11 Download gff for MIP06329.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17841120..17841512 31..423 100 <- Minus
arm_2R 17841571..17841600 1..30 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:31 Download gff for MIP06329.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21954814..21955206 31..423 100 <- Minus
2R 21955265..21955294 1..30 100   Minus

MIP06329.pep Sequence

Translation from 85 to 354

> MIP06329.pep
MAELDATTLSEYDIEYIDFNMTTVAYRTTTGHPDTNLGAWGLLFIFVVIF
LIIAACCACMGVLVLFGCMKSFLCFRCRRRGDEFIGREP*
Sequence MIP06329.pep has no blast hits.

MIP06329.hyp Sequence

Translation from 85 to 354

> MIP06329.hyp
MAELDATTLSEYDIEYIDFNMTTVAYRTTTGHPDTNLGAWGLLFIFVVIF
LIIAACCACMGVLVLFGCMKSFLCFRCRRRGDEFIGREP*
Sequence MIP06329.hyp has no blast hits.