Clone MIP06336 Report

Search the DGRC for MIP06336

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:63
Well:36
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptSfp24Bb-RA
Protein status:MIP06336.pep: gold
Sequenced Size:479

Clone Sequence Records

MIP06336.complete Sequence

479 bp assembled on 2009-02-20

GenBank Submission: BT064662.1

> MIP06336.complete
CCCAGTTATACTGTACACTTTCGTCATTTTCAACCATCGCAAGAAGATAG
TGTACAAATCGTGAAAATGAAATTCGTGATATTGCTATCCTTGATGTGCA
TCGGAATTGGTTATGCCCAACAACAGTCGGAAGTCAAATGCTTCATGGAC
GCCATTCCTGTGGGCGAATGTGGTAGTCGGATTATAGGGTATAGCTATTC
GAGTGTAAGAGCCCGTTGCGTAAACTATGAGACCATAGGTTGCGAGGTCA
TCGGAAATTTCTTCACCGACAGGAAAGTGTGTGAGGCCAAATGCAAACCG
CCGATCAGTTTTAGAAACAATCCATTCAGTTATTATTTCGAAAGAGCTTT
TAACCAGGCCCGCGATACTTTAAGAAGAATATTCAATCTACCTCAGTAAA
ATAATTATGTGGAAGAAATAAAGAATATCAATTTAATTGCACTGTTAATA
AGCCAGAAAAACAAAAAAAAAAAAAAAAA

MIP06336.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24Bb-RA 574 Sfp24Bb-RA 52..511 1..460 2300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3668762..3669090 460..132 1600 99.1 Minus
chr2L 23010047 chr2L 3669148..3669280 133..1 650 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3669257..3669585 460..132 1645 100 Minus
2L 23513712 2L 3669643..3669775 133..1 665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3669257..3669585 460..132 1645 100 Minus
2L 23513712 2L 3669643..3669775 133..1 665 100 Minus
Blast to na_te.dros performed on 2019-03-15 14:51:26 has no hits.

MIP06336.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:52:20 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3668759..3669088 134..462 98 <- Minus
chr2L 3669148..3669280 1..133 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:10 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 1..333 67..399 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:36:50 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 1..333 67..399 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:46:27 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 1..333 67..399 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:22 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 1..333 67..399 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-20 22:04:08 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 1..395 59..453 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:36:50 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 1..456 1..456 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:46:27 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 1..456 1..456 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:22 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 1..456 1..456 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:20 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3669254..3669583 134..462 99 <- Minus
2L 3669643..3669775 1..133 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:20 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3669254..3669583 134..462 99 <- Minus
2L 3669643..3669775 1..133 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:20 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3669254..3669583 134..462 99 <- Minus
2L 3669643..3669775 1..133 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:46:27 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3669254..3669583 134..462 99 <- Minus
arm_2L 3669643..3669775 1..133 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:29 Download gff for MIP06336.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3669254..3669583 134..462 99 <- Minus
2L 3669643..3669775 1..133 100   Minus

MIP06336.pep Sequence

Translation from 0 to 398

> MIP06336.pep
PSYTVHFRHFQPSQEDSVQIVKMKFVILLSLMCIGIGYAQQQSEVKCFMD
AIPVGECGSRIIGYSYSSVRARCVNYETIGCEVIGNFFTDRKVCEAKCKP
PISFRNNPFSYYFERAFNQARDTLRRIFNLPQ*

MIP06336.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14658-PA 110 GF14658-PA 1..109 23..131 249 41.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24Bb-PA 110 CG42462-PA 1..110 23..132 589 100 Plus
Sfp24Bd-PB 111 CG42463-PB 13..97 29..119 148 35.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22739-PA 111 GD22739-PA 1..97 23..119 226 49.5 Plus

MIP06336.hyp Sequence

Translation from 0 to 398

> MIP06336.hyp
PSYTVHFRHFQPSQEDSVQIVKMKFVILLSLMCIGIGYAQQQSEVKCFMD
AIPVGECGSRIIGYSYSSVRARCVNYETIGCEVIGNFFTDRKVCEAKCKP
PISFRNNPFSYYFERAFNQARDTLRRIFNLPQ*

MIP06336.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24Bb-PA 110 CG42462-PA 1..110 23..132 589 100 Plus
CG42463-PB 111 CG42463-PB 13..97 29..119 148 35.2 Plus