Clone MIP06396 Report

Search the DGRC for MIP06396

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:63
Well:96
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43250-RA
Protein status:MIP06396.pep: wuzgold
Sequenced Size:365

Clone Sequence Records

MIP06396.complete Sequence

365 bp assembled on 2009-02-24

GenBank Submission: BT070225.1

> MIP06396.complete
GAGAGAGCGGCTAAAAGTATCCGAAAAAGAACGTAACACAAACGATCTGA
TAAAATAAGAACGCACGATGATGACGCCCGATCCAGAACAACCGTTAAGT
GCTCCACCCCAAATGATGCTGCAACAGGGTGAGCGAAAGAGAGGGCGAGC
CCGATACCGAAAGAGACAGAGGCAGAGCCGAACAGAAACGACAGTGAAAG
TTCTACACTTTCGCTTTTTCACAGAACCCTGCTATCATACGAAAAGCAGC
AATCGTAGAGATAGAAACCTTTGGAAATACAATACATAGTACATCAGCAA
ATGTGCGGTTGAATAAAACACCATGAGGTCCATTGGAATACAAAAAAAAA
AAAAAAAAAAAAAAA

MIP06396.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
MB8.chr3L.pasa.55.a 376 MB8.chr3L.pasa.55.a 1..340 1..340 1685 99.7 Plus
MB8.chr3L.pasa.63.a 371 MB8.chr3L.pasa.63.a 1..335 1..340 1585 98.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17022808..17023116 309..1 1500 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:07:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17033368..17033676 309..1 1530 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17026468..17026776 309..1 1530 99.6 Minus
3L 28103327 3L 17026220..17026253 340..307 170 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:15:29 has no hits.

MIP06396.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:16:35 Download gff for MIP06396.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17022559..17022592 308..341 97 <- Minus
chr3L 17022810..17023116 1..307 99   Minus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:22:08 Download gff for MIP06396.complete
Subject Subject Range Query Range Percent Splice Strand
CG43250-RA 1..222 68..289 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:22:08 Download gff for MIP06396.complete
Subject Subject Range Query Range Percent Splice Strand
CG43250-RA 1..340 1..341 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:16:35 Download gff for MIP06396.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17033370..17033676 1..307 99   Minus
3L 17033119..17033152 308..341 97 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:16:35 Download gff for MIP06396.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17033370..17033676 1..307 99   Minus
3L 17033119..17033152 308..341 97 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:16:35 Download gff for MIP06396.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17033370..17033676 1..307 99   Minus
3L 17033119..17033152 308..341 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:22:08 Download gff for MIP06396.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17026470..17026776 1..307 99   Minus
arm_3L 17026219..17026252 308..341 97 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:34 Download gff for MIP06396.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17026470..17026776 1..307 99   Minus
3L 17026219..17026252 308..341 97 <- Minus

MIP06396.pep Sequence

Translation from 67 to 288

> MIP06396.pep
MMTPDPEQPLSAPPQMMLQQGERKRGRARYRKRQRQSRTETTVKVLHFRF
FTEPCYHTKSSNRRDRNLWKYNT*
Sequence MIP06396.pep has no blast hits.

MIP06396.hyp Sequence

Translation from 67 to 288

> MIP06396.hyp
MMTPDPEQPLSAPPQMMLQQGERKRGRARYRKRQRQSRTETTVKVLHFRF
FTEPCYHTKSSNRRDRNLWKYNT*
Sequence MIP06396.hyp has no blast hits.