Clone MIP06488 Report

Search the DGRC for MIP06488

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:64
Well:88
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43233-RA
Protein status:MIP06488.pep: gold
Sequenced Size:499

Clone Sequence Records

MIP06488.complete Sequence

499 bp assembled on 2009-04-08

GenBank Submission: BT082014.1

> MIP06488.complete
AGAAAAACCTGCTGATAGCAATTATGTGTGTGCGTCTCGTTGGATCCGCT
CTCTGTTGCTGTTGCAAATTGGGCCTCAAGTGCCTGTGCATCTTCGCCTG
TTCCACGGTCGGTGTTCTCGCCATAGTTGCCTTGGTCGTTTACTTTTGTT
TCTTCCACAACAAATCGGAGGACTCGACCACAAAGTCTCTCTCTGATTCT
ACTATCGATAAGTCCTTGAAGGATAGCATAACTACTGCAACGGAAGCCCC
TTCACTCGTCAGAGGATATCTCCAACAAATGATAGAAAGAATCTAAAATG
TAATGTAATGTATAAATTACTATCGCATATCATATATCACATCTCCAGGA
GTGCACAATTTTTGAAATGGAAATGGAAACCCCCAAAAGTATCTTTCAGC
TAAATTGGAAGTTGGAGAAATTGATAGATTTGTGTTTTGTGAATTCCTAA
CATTTGAATATATAATTTTATTATTATTTTCCAAAAAAAAAAAAAAAAA

MIP06488.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
nc_3992.a 479 nc_3992.a 14..479 1..466 2330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20471235..20471659 482..58 2125 100 Minus
chr2L 23010047 chr2L 20471711..20471768 58..1 290 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:07:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20472791..20473217 484..58 2135 100 Minus
2L 23513712 2L 20473269..20473326 58..1 290 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20472791..20473217 484..58 2135 100 Minus
2L 23513712 2L 20473269..20473326 58..1 290 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:22:57 has no hits.

MIP06488.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:24:14 Download gff for MIP06488.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20471235..20471658 59..482 100 <- Minus
chr2L 20471711..20471768 1..58 100   Minus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:44 Download gff for MIP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG43233-RA 1..273 24..296 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:38:18 Download gff for MIP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG43233-RA 1..273 24..296 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:44 Download gff for MIP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG43233-RA 60..541 1..482 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:38:18 Download gff for MIP06488.complete
Subject Subject Range Query Range Percent Splice Strand
CG43233-RA 60..541 1..482 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:24:14 Download gff for MIP06488.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20472793..20473216 59..482 100 <- Minus
2L 20473269..20473326 1..58 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:24:14 Download gff for MIP06488.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20472793..20473216 59..482 100 <- Minus
2L 20473269..20473326 1..58 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:24:14 Download gff for MIP06488.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20472793..20473216 59..482 100 <- Minus
2L 20473269..20473326 1..58 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:44 Download gff for MIP06488.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20472793..20473216 59..482 100 <- Minus
arm_2L 20473269..20473326 1..58 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:46 Download gff for MIP06488.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20472793..20473216 59..482 100 <- Minus
2L 20473269..20473326 1..58 100   Minus

MIP06488.pep Sequence

Translation from 2 to 295

> MIP06488.pep
KNLLIAIMCVRLVGSALCCCCKLGLKCLCIFACSTVGVLAIVALVVYFCF
FHNKSEDSTTKSLSDSTIDKSLKDSITTATEAPSLVRGYLQQMIERI*

MIP06488.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG43233-PA 90 CG43233-PA 1..90 8..97 467 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26029-PA 100 GA26029-PA 1..59 8..67 141 58.3 Plus

MIP06488.hyp Sequence

Translation from 2 to 295

> MIP06488.hyp
KNLLIAIMCVRLVGSALCCCCKLGLKCLCIFACSTVGVLAIVALVVYFCF
FHNKSEDSTTKSLSDSTIDKSLKDSITTATEAPSLVRGYLQQMIERI*

MIP06488.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG43233-PA 90 CG43233-PA 1..90 8..97 467 100 Plus