Clone Sequence Records
MIP06863.complete Sequence
640 bp assembled on 2009-03-10
GenBank Submission: BT072848.1
> MIP06863.complete
CGCCAATATGAAGTTTATGGCAATATGCCTATTGGCAAATATTGGCTACA
TACTTGGCACTACAATTGGCCAGCTTAATGACGAAGCCACAATTCGACTA
AAGGGACTTGTGGAGAAATATAAACTGCAAGCTCTTAGCAATCCCGAATT
CTCTCAGTGGATTGGCAAACTTGAGAAAACTAGCAAGTCGAGAAGATTGG
AAGACAAAATGAAGGTCAAAGCTGAATTTAAAAACTACGACGAACGTCGC
TTGCAATTGGAAAATAAAATTAGGGAACGCATTACGGCGATCGATGACCT
CATATCCGATATTATGGCCAAAGTCCCGATAAAGGATAAAGGGTGTCTCA
AGTATTACCAACGCCAGAAAAGATCCCTTAAATTGGCCCACAATTTTTCG
AATTTAACTAAGCAAACAAACCTCATACGCAACTCGAAACAATGCGAAAC
AACTAAAGTGCAGTCTAGTGAACTAAGTGAAAGCTCTGAAAATCCGGATG
AGTATAGTTATTACTAAGCTAGTATTACTAGTATCTAGATAGTGCATTAT
ATCAATATATACACATATATGTATCTTTCGAGAGCTTCCAGCAACGAGTT
TCCGGCCCTGTTAATATTGATTATAAAAAAAAAAAAAAAA
MIP06863.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:26:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp38D.a | 1237 | Sfp38D.a | 20..645 | 1..626 | 3130 | 100 | Plus |
Sfp38D-RA | 643 | Sfp38D-RA | 20..643 | 1..624 | 3120 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:56:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 20639489..20640062 | 51..624 | 2870 | 100 | Plus |
chr2L | 23010047 | chr2L | 20639373..20639422 | 1..50 | 250 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:07:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:56:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 20641049..20641624 | 51..626 | 2880 | 100 | Plus |
2L | 23513712 | 2L | 20640933..20640982 | 1..50 | 250 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 20641049..20641624 | 51..626 | 2880 | 100 | Plus |
2L | 23513712 | 2L | 20640933..20640982 | 1..50 | 250 | 100 | Plus |
Blast to na_te.dros performed 2019-03-15 23:56:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\Mar | 610 | Dwil\Mar MAR 610bp Derived from AF518731. | 277..350 | 574..501 | 117 | 65.3 | Minus |
transib4 | 2656 | transib4 TRANSIB4 2656bp | 2095..2195 | 434..533 | 114 | 60.8 | Plus |
Bari1 | 1728 | Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). | 207..331 | 516..391 | 113 | 60.8 | Minus |
MIP06863.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:57:19 Download gff for
MIP06863.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 20639373..20639422 | 1..50 | 100 | -> | Plus |
chr2L | 20639489..20640062 | 51..624 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:33 Download gff for
MIP06863.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp38D-RA | 1..510 | 8..517 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:32:16 Download gff for
MIP06863.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp38D-RA | 1..510 | 8..517 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:52:13 Download gff for
MIP06863.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp38D-RA | 1..510 | 8..517 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:33 Download gff for
MIP06863.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp38D-RA | 17..640 | 1..624 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:32:16 Download gff for
MIP06863.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp38D-RA | 17..640 | 1..624 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:52:13 Download gff for
MIP06863.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp38D-RA | 17..640 | 1..624 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:57:19 Download gff for
MIP06863.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 20640933..20640982 | 1..50 | 100 | -> | Plus |
2L | 20641049..20641622 | 51..624 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:57:19 Download gff for
MIP06863.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 20640933..20640982 | 1..50 | 100 | -> | Plus |
2L | 20641049..20641622 | 51..624 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:57:19 Download gff for
MIP06863.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 20640933..20640982 | 1..50 | 100 | -> | Plus |
2L | 20641049..20641622 | 51..624 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:32:16 Download gff for
MIP06863.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 20640933..20640982 | 1..50 | 100 | -> | Plus |
arm_2L | 20641049..20641622 | 51..624 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:39 Download gff for
MIP06863.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 20641049..20641622 | 51..624 | 100 | | Plus |
2L | 20640933..20640982 | 1..50 | 100 | -> | Plus |
MIP06863.hyp Sequence
Translation from 0 to 516
> MIP06863.hyp
ANMKFMAICLLANIGYILGTTIGQLNDEATIRLKGLVEKYKLQALSNPEF
SQWIGKLEKTSKSRRLEDKMKVKAEFKNYDERRLQLENKIRERITAIDDL
ISDIMAKVPIKDKGCLKYYQRQKRSLKLAHNFSNLTKQTNLIRNSKQCET
TKVQSSELSESSENPDEYSYY*
MIP06863.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:40:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp38D-PB | 169 | CG42606-PB | 1..169 | 3..171 | 858 | 100 | Plus |
Sfp38D-PA | 169 | CG42606-PA | 1..169 | 3..171 | 858 | 100 | Plus |
CG17472-PA | 159 | CG17472-PA | 1..142 | 3..148 | 232 | 36.1 | Plus |
CG31680-PA | 147 | CG31680-PA | 1..129 | 3..148 | 211 | 33.6 | Plus |
MIP06863.pep Sequence
Translation from 1 to 516
> MIP06863.pep
ANMKFMAICLLANIGYILGTTIGQLNDEATIRLKGLVEKYKLQALSNPEF
SQWIGKLEKTSKSRRLEDKMKVKAEFKNYDERRLQLENKIRERITAIDDL
ISDIMAKVPIKDKGCLKYYQRQKRSLKLAHNFSNLTKQTNLIRNSKQCET
TKVQSSELSESSENPDEYSYY*
MIP06863.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:13:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF21961-PA | 172 | GF21961-PA | 28..165 | 30..165 | 149 | 31.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:13:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG21241-PA | 160 | GG21241-PA | 1..144 | 3..150 | 209 | 33.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp38D-PB | 169 | CG42606-PB | 1..169 | 3..171 | 858 | 100 | Plus |
Sfp38D-PA | 169 | CG42606-PA | 1..169 | 3..171 | 858 | 100 | Plus |
CG17472-PA | 159 | CG17472-PA | 1..142 | 3..148 | 232 | 36.1 | Plus |
CG31680-PA | 147 | CG31680-PA | 1..129 | 3..148 | 211 | 33.6 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:13:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL26166-PA | 181 | GL26166-PA | 40..163 | 22..148 | 175 | 34.9 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:13:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA14521-PA | 167 | GA14521-PA | 14..149 | 14..148 | 177 | 34.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:13:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23355-PA | 160 | GM23355-PA | 1..143 | 3..148 | 233 | 38.5 | Plus |
Dsec\GM23356-PA | 159 | GM23356-PA | 1..147 | 3..153 | 224 | 35.5 | Plus |
Dsec\GM23357-PA | 147 | GM23357-PA | 1..129 | 3..148 | 195 | 32.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:13:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24265-PA | 159 | GD24265-PA | 1..147 | 3..153 | 247 | 38.2 | Plus |
Dsim\GD24269-PA | 159 | GD24269-PA | 1..147 | 3..153 | 226 | 36.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:13:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13314-PA | 163 | GE13314-PA | 1..146 | 3..152 | 215 | 37.7 | Plus |