Clone MIP06863 Report

Search the DGRC for MIP06863

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:68
Well:63
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptSfp38D-RA
Protein status:MIP06863.pep: gold
Sequenced Size:640

Clone Sequence Records

MIP06863.complete Sequence

640 bp assembled on 2009-03-10

GenBank Submission: BT072848.1

> MIP06863.complete
CGCCAATATGAAGTTTATGGCAATATGCCTATTGGCAAATATTGGCTACA
TACTTGGCACTACAATTGGCCAGCTTAATGACGAAGCCACAATTCGACTA
AAGGGACTTGTGGAGAAATATAAACTGCAAGCTCTTAGCAATCCCGAATT
CTCTCAGTGGATTGGCAAACTTGAGAAAACTAGCAAGTCGAGAAGATTGG
AAGACAAAATGAAGGTCAAAGCTGAATTTAAAAACTACGACGAACGTCGC
TTGCAATTGGAAAATAAAATTAGGGAACGCATTACGGCGATCGATGACCT
CATATCCGATATTATGGCCAAAGTCCCGATAAAGGATAAAGGGTGTCTCA
AGTATTACCAACGCCAGAAAAGATCCCTTAAATTGGCCCACAATTTTTCG
AATTTAACTAAGCAAACAAACCTCATACGCAACTCGAAACAATGCGAAAC
AACTAAAGTGCAGTCTAGTGAACTAAGTGAAAGCTCTGAAAATCCGGATG
AGTATAGTTATTACTAAGCTAGTATTACTAGTATCTAGATAGTGCATTAT
ATCAATATATACACATATATGTATCTTTCGAGAGCTTCCAGCAACGAGTT
TCCGGCCCTGTTAATATTGATTATAAAAAAAAAAAAAAAA

MIP06863.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp38D.a 1237 Sfp38D.a 20..645 1..626 3130 100 Plus
Sfp38D-RA 643 Sfp38D-RA 20..643 1..624 3120 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20639489..20640062 51..624 2870 100 Plus
chr2L 23010047 chr2L 20639373..20639422 1..50 250 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:07:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20641049..20641624 51..626 2880 100 Plus
2L 23513712 2L 20640933..20640982 1..50 250 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20641049..20641624 51..626 2880 100 Plus
2L 23513712 2L 20640933..20640982 1..50 250 100 Plus
Blast to na_te.dros performed 2019-03-15 23:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\Mar 610 Dwil\Mar MAR 610bp Derived from AF518731. 277..350 574..501 117 65.3 Minus
transib4 2656 transib4 TRANSIB4 2656bp 2095..2195 434..533 114 60.8 Plus
Bari1 1728 Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). 207..331 516..391 113 60.8 Minus

MIP06863.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:57:19 Download gff for MIP06863.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20639373..20639422 1..50 100 -> Plus
chr2L 20639489..20640062 51..624 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:33 Download gff for MIP06863.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp38D-RA 1..510 8..517 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:32:16 Download gff for MIP06863.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp38D-RA 1..510 8..517 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:52:13 Download gff for MIP06863.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp38D-RA 1..510 8..517 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:33 Download gff for MIP06863.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp38D-RA 17..640 1..624 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:32:16 Download gff for MIP06863.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp38D-RA 17..640 1..624 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:52:13 Download gff for MIP06863.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp38D-RA 17..640 1..624 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:57:19 Download gff for MIP06863.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20640933..20640982 1..50 100 -> Plus
2L 20641049..20641622 51..624 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:57:19 Download gff for MIP06863.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20640933..20640982 1..50 100 -> Plus
2L 20641049..20641622 51..624 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:57:19 Download gff for MIP06863.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20640933..20640982 1..50 100 -> Plus
2L 20641049..20641622 51..624 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:32:16 Download gff for MIP06863.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20640933..20640982 1..50 100 -> Plus
arm_2L 20641049..20641622 51..624 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:39 Download gff for MIP06863.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20641049..20641622 51..624 100   Plus
2L 20640933..20640982 1..50 100 -> Plus

MIP06863.hyp Sequence

Translation from 0 to 516

> MIP06863.hyp
ANMKFMAICLLANIGYILGTTIGQLNDEATIRLKGLVEKYKLQALSNPEF
SQWIGKLEKTSKSRRLEDKMKVKAEFKNYDERRLQLENKIRERITAIDDL
ISDIMAKVPIKDKGCLKYYQRQKRSLKLAHNFSNLTKQTNLIRNSKQCET
TKVQSSELSESSENPDEYSYY*

MIP06863.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp38D-PB 169 CG42606-PB 1..169 3..171 858 100 Plus
Sfp38D-PA 169 CG42606-PA 1..169 3..171 858 100 Plus
CG17472-PA 159 CG17472-PA 1..142 3..148 232 36.1 Plus
CG31680-PA 147 CG31680-PA 1..129 3..148 211 33.6 Plus

MIP06863.pep Sequence

Translation from 1 to 516

> MIP06863.pep
ANMKFMAICLLANIGYILGTTIGQLNDEATIRLKGLVEKYKLQALSNPEF
SQWIGKLEKTSKSRRLEDKMKVKAEFKNYDERRLQLENKIRERITAIDDL
ISDIMAKVPIKDKGCLKYYQRQKRSLKLAHNFSNLTKQTNLIRNSKQCET
TKVQSSELSESSENPDEYSYY*

MIP06863.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21961-PA 172 GF21961-PA 28..165 30..165 149 31.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21241-PA 160 GG21241-PA 1..144 3..150 209 33.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp38D-PB 169 CG42606-PB 1..169 3..171 858 100 Plus
Sfp38D-PA 169 CG42606-PA 1..169 3..171 858 100 Plus
CG17472-PA 159 CG17472-PA 1..142 3..148 232 36.1 Plus
CG31680-PA 147 CG31680-PA 1..129 3..148 211 33.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26166-PA 181 GL26166-PA 40..163 22..148 175 34.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14521-PA 167 GA14521-PA 14..149 14..148 177 34.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23355-PA 160 GM23355-PA 1..143 3..148 233 38.5 Plus
Dsec\GM23356-PA 159 GM23356-PA 1..147 3..153 224 35.5 Plus
Dsec\GM23357-PA 147 GM23357-PA 1..129 3..148 195 32.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24265-PA 159 GD24265-PA 1..147 3..153 247 38.2 Plus
Dsim\GD24269-PA 159 GD24269-PA 1..147 3..153 226 36.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13314-PA 163 GE13314-PA 1..146 3..152 215 37.7 Plus