MIP06907.complete Sequence
332 bp assembled on 2009-03-10
GenBank Submission: BT072852.1
> MIP06907.complete
AGTCGACTTGTACACCTTGCACGGTTCAAAAAATGAAGTTACTCTGGCTG
CTGTTAGTGGGCGTTGTTGCCGGGCAACCTTGTGATAAGCTCTGTCCCAT
CAATAATAACTTCGGATGTGTCAGCAAGGACAATAAATGCTTTTACACCG
TTCGCAATCCATGTATTTTGAAGGCCATTAACTGCTATCGTAAATCGAAG
AACTTATCTGTTTTGAAGCCCATTTTGCGCAGCAAGTGCACCAATAAGGA
AGTTCCAGTTTGCGAGAATATCAATAAATAGTTGCATTAATGTAAATATA
TATAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
MIP06907.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:26:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MB8.chr2L.pasa.4.c | 730 | MB8.chr2L.pasa.4.c | 10..313 | 1..304 | 1520 | 100 | Plus |
MB8.chr2L.pasa.4.b | 867 | MB8.chr2L.pasa.4.b | 10..313 | 1..304 | 1520 | 100 | Plus |
MB8.chr2L.pasa.4.a | 312 | MB8.chr2L.pasa.4.a | 10..312 | 1..303 | 1515 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:09:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 4437060..4437210 | 60..210 | 755 | 100 | Plus |
chr2L | 23010047 | chr2L | 4437263..4437356 | 210..303 | 470 | 100 | Plus |
chr2L | 23010047 | chr2L | 4436942..4437002 | 1..61 | 305 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:07:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:09:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4437905..4438055 | 60..210 | 755 | 100 | Plus |
2L | 23513712 | 2L | 4438108..4438202 | 210..304 | 475 | 100 | Plus |
2L | 23513712 | 2L | 4437787..4437847 | 1..61 | 305 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4437905..4438055 | 60..210 | 755 | 100 | Plus |
2L | 23513712 | 2L | 4438108..4438202 | 210..304 | 475 | 100 | Plus |
2L | 23513712 | 2L | 4437787..4437847 | 1..61 | 305 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 11:09:19 has no hits.
MIP06907.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:10:19 Download gff for
MIP06907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 4436942..4437001 | 1..60 | 100 | -> | Plus |
chr2L | 4437061..4437210 | 61..210 | 100 | -> | Plus |
chr2L | 4437264..4437356 | 211..303 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:38 Download gff for
MIP06907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43056-RA | 1..249 | 33..281 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:37:16 Download gff for
MIP06907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43056-RA | 1..249 | 33..281 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:28:52 Download gff for
MIP06907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43056-RA | 1..249 | 33..281 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:38 Download gff for
MIP06907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43056-RA | 1..303 | 1..303 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:37:16 Download gff for
MIP06907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43056-RA | 1..303 | 1..303 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:28:52 Download gff for
MIP06907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43056-RA | 1..303 | 1..303 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:19 Download gff for
MIP06907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4437787..4437846 | 1..60 | 100 | -> | Plus |
2L | 4437906..4438055 | 61..210 | 100 | -> | Plus |
2L | 4438109..4438201 | 211..303 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:19 Download gff for
MIP06907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4437787..4437846 | 1..60 | 100 | -> | Plus |
2L | 4437906..4438055 | 61..210 | 100 | -> | Plus |
2L | 4438109..4438201 | 211..303 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:19 Download gff for
MIP06907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4437787..4437846 | 1..60 | 100 | -> | Plus |
2L | 4437906..4438055 | 61..210 | 100 | -> | Plus |
2L | 4438109..4438201 | 211..303 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:37:16 Download gff for
MIP06907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 4437906..4438055 | 61..210 | 100 | -> | Plus |
arm_2L | 4438109..4438201 | 211..303 | 100 | | Plus |
arm_2L | 4437787..4437846 | 1..60 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:45 Download gff for
MIP06907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4437787..4437846 | 1..60 | 100 | -> | Plus |
2L | 4437906..4438055 | 61..210 | 100 | -> | Plus |
2L | 4438109..4438201 | 211..303 | 100 | | Plus |
MIP06907.pep Sequence
Translation from 2 to 280
> MIP06907.pep
STCTPCTVQKMKLLWLLLVGVVAGQPCDKLCPINNNFGCVSKDNKCFYTV
RNPCILKAINCYRKSKNLSVLKPILRSKCTNKEVPVCENINK*
MIP06907.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43056-PA | 82 | CG43056-PA | 1..82 | 11..92 | 450 | 100 | Plus |
MIP06907.hyp Sequence
Translation from 2 to 280
> MIP06907.hyp
STCTPCTVQKMKLLWLLLVGVVAGQPCDKLCPINNNFGCVSKDNKCFYTV
RNPCILKAINCYRKSKNLSVLKPILRSKCTNKEVPVCENINK*
MIP06907.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43056-PA | 82 | CG43056-PA | 1..82 | 11..92 | 450 | 100 | Plus |