Clone MIP06907 Report

Search the DGRC for MIP06907

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:69
Well:7
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43056-RA
Protein status:MIP06907.pep: gold
Sequenced Size:332

Clone Sequence Records

MIP06907.complete Sequence

332 bp assembled on 2009-03-10

GenBank Submission: BT072852.1

> MIP06907.complete
AGTCGACTTGTACACCTTGCACGGTTCAAAAAATGAAGTTACTCTGGCTG
CTGTTAGTGGGCGTTGTTGCCGGGCAACCTTGTGATAAGCTCTGTCCCAT
CAATAATAACTTCGGATGTGTCAGCAAGGACAATAAATGCTTTTACACCG
TTCGCAATCCATGTATTTTGAAGGCCATTAACTGCTATCGTAAATCGAAG
AACTTATCTGTTTTGAAGCCCATTTTGCGCAGCAAGTGCACCAATAAGGA
AGTTCCAGTTTGCGAGAATATCAATAAATAGTTGCATTAATGTAAATATA
TATAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP06907.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
MB8.chr2L.pasa.4.c 730 MB8.chr2L.pasa.4.c 10..313 1..304 1520 100 Plus
MB8.chr2L.pasa.4.b 867 MB8.chr2L.pasa.4.b 10..313 1..304 1520 100 Plus
MB8.chr2L.pasa.4.a 312 MB8.chr2L.pasa.4.a 10..312 1..303 1515 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4437060..4437210 60..210 755 100 Plus
chr2L 23010047 chr2L 4437263..4437356 210..303 470 100 Plus
chr2L 23010047 chr2L 4436942..4437002 1..61 305 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:07:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4437905..4438055 60..210 755 100 Plus
2L 23513712 2L 4438108..4438202 210..304 475 100 Plus
2L 23513712 2L 4437787..4437847 1..61 305 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4437905..4438055 60..210 755 100 Plus
2L 23513712 2L 4438108..4438202 210..304 475 100 Plus
2L 23513712 2L 4437787..4437847 1..61 305 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:09:19 has no hits.

MIP06907.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:10:19 Download gff for MIP06907.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4436942..4437001 1..60 100 -> Plus
chr2L 4437061..4437210 61..210 100 -> Plus
chr2L 4437264..4437356 211..303 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:38 Download gff for MIP06907.complete
Subject Subject Range Query Range Percent Splice Strand
CG43056-RA 1..249 33..281 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:37:16 Download gff for MIP06907.complete
Subject Subject Range Query Range Percent Splice Strand
CG43056-RA 1..249 33..281 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:28:52 Download gff for MIP06907.complete
Subject Subject Range Query Range Percent Splice Strand
CG43056-RA 1..249 33..281 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:38 Download gff for MIP06907.complete
Subject Subject Range Query Range Percent Splice Strand
CG43056-RA 1..303 1..303 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:37:16 Download gff for MIP06907.complete
Subject Subject Range Query Range Percent Splice Strand
CG43056-RA 1..303 1..303 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:28:52 Download gff for MIP06907.complete
Subject Subject Range Query Range Percent Splice Strand
CG43056-RA 1..303 1..303 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:19 Download gff for MIP06907.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4437787..4437846 1..60 100 -> Plus
2L 4437906..4438055 61..210 100 -> Plus
2L 4438109..4438201 211..303 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:19 Download gff for MIP06907.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4437787..4437846 1..60 100 -> Plus
2L 4437906..4438055 61..210 100 -> Plus
2L 4438109..4438201 211..303 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:19 Download gff for MIP06907.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4437787..4437846 1..60 100 -> Plus
2L 4437906..4438055 61..210 100 -> Plus
2L 4438109..4438201 211..303 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:37:16 Download gff for MIP06907.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4437906..4438055 61..210 100 -> Plus
arm_2L 4438109..4438201 211..303 100   Plus
arm_2L 4437787..4437846 1..60 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:45 Download gff for MIP06907.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4437787..4437846 1..60 100 -> Plus
2L 4437906..4438055 61..210 100 -> Plus
2L 4438109..4438201 211..303 100   Plus

MIP06907.pep Sequence

Translation from 2 to 280

> MIP06907.pep
STCTPCTVQKMKLLWLLLVGVVAGQPCDKLCPINNNFGCVSKDNKCFYTV
RNPCILKAINCYRKSKNLSVLKPILRSKCTNKEVPVCENINK*

MIP06907.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG43056-PA 82 CG43056-PA 1..82 11..92 450 100 Plus

MIP06907.hyp Sequence

Translation from 2 to 280

> MIP06907.hyp
STCTPCTVQKMKLLWLLLVGVVAGQPCDKLCPINNNFGCVSKDNKCFYTV
RNPCILKAINCYRKSKNLSVLKPILRSKCTNKEVPVCENINK*

MIP06907.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG43056-PA 82 CG43056-PA 1..82 11..92 450 100 Plus