MIP06912.complete Sequence
481 bp assembled on 2009-03-10
GenBank Submission: BT072853.1
> MIP06912.complete
CGCTAAGTATCTACAGGCTGTGTAGTTCAACAAGAAACCCTTTTCTTTAA
AAATGTGCAATTGATAACTTAAGTCCCCTTTTTTACTCATAAAAATCAAT
ATATTTTTTATGACCCTAGCGACTGTGATGTGTTGTAAATTGATTTAATG
GCCAAATGCTCACTTTGAAGCTCGAGAGTGCGTTATAAACTGACATCGAA
TGAAGCCGGGCCCATTTACGCAAGTTGACTGTACAAACGCCATGCATTTG
AGACAACTCCTTACCGAAATGGTTATTATCTTGACCATATTGACCATTCC
TGGCTATACCATTCACACCTTGGCAGAGAAGAAAATCAGCCAATATCCTT
GGATCCCGAAGACGTCAACGCATATTACACCTTATAAGATATCTGGGGAT
ATATGAAATATGAAATGTGTTATTATGTATGAATAAATTTCGACGAATTT
GTCTGCCCAACAATAAAAAAAAAAAAAAAAA
MIP06912.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:26:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
DMG8-chr2L.11.009.d | 549 | DMG8-chr2L.11.009.d | 45..509 | 1..465 | 2325 | 100 | Plus |
DMG8-chr2L.11.009.c | 438 | DMG8-chr2L.11.009.c | 68..415 | 118..465 | 1740 | 100 | Plus |
DMG8-chr2L.11.009.a | 484 | DMG8-chr2L.11.009.a | 99..444 | 120..465 | 1730 | 100 | Plus |
DMG8-chr2L.11.009.a | 484 | DMG8-chr2L.11.009.a | 45..98 | 1..54 | 270 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:28:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 5883983..5884254 | 1..272 | 1360 | 100 | Plus |
chr2L | 23010047 | chr2L | 5884316..5884508 | 272..464 | 965 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:07:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:28:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5884932..5885203 | 1..272 | 1360 | 100 | Plus |
2L | 23513712 | 2L | 5885265..5885458 | 272..465 | 970 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5884932..5885203 | 1..272 | 1360 | 100 | Plus |
2L | 23513712 | 2L | 5885265..5885458 | 272..465 | 970 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 23:28:33 has no hits.
MIP06912.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:29:42 Download gff for
MIP06912.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 5883983..5884254 | 1..272 | 100 | -> | Plus |
chr2L | 5884317..5884508 | 273..464 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:41:37 Download gff for
MIP06912.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43185-RB | 1..207 | 200..406 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:35:46 Download gff for
MIP06912.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43185-RC | 1..165 | 242..406 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:41:37 Download gff for
MIP06912.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43185-RA | 1..464 | 1..464 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:35:46 Download gff for
MIP06912.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43185-RC | 1..464 | 1..464 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:29:42 Download gff for
MIP06912.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5885266..5885457 | 273..464 | 100 | | Plus |
2L | 5884932..5885203 | 1..272 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:29:42 Download gff for
MIP06912.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5885266..5885457 | 273..464 | 100 | | Plus |
2L | 5884932..5885203 | 1..272 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:29:42 Download gff for
MIP06912.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5885266..5885457 | 273..464 | 100 | | Plus |
2L | 5884932..5885203 | 1..272 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:41:37 Download gff for
MIP06912.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5884932..5885203 | 1..272 | 100 | -> | Plus |
arm_2L | 5885266..5885457 | 273..464 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:46 Download gff for
MIP06912.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5884932..5885203 | 1..272 | 100 | -> | Plus |
2L | 5885266..5885457 | 273..464 | 100 | | Plus |
MIP06912.pep Sequence
Translation from 199 to 405
> MIP06912.pep
MKPGPFTQVDCTNAMHLRQLLTEMVIILTILTIPGYTIHTLAEKKISQYP
WIPKTSTHITPYKISGDI*
MIP06912.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43185-PD | 54 | CG43185-PD | 1..54 | 15..68 | 281 | 100 | Plus |
CG43185-PC | 54 | CG43185-PC | 1..54 | 15..68 | 281 | 100 | Plus |
MIP06912.hyp Sequence
Translation from 199 to 405
> MIP06912.hyp
MKPGPFTQVDCTNAMHLRQLLTEMVIILTILTIPGYTIHTLAEKKISQYP
WIPKTSTHITPYKISGDI*
MIP06912.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43185-PD | 54 | CG43185-PD | 1..54 | 15..68 | 281 | 100 | Plus |
CG43185-PC | 54 | CG43185-PC | 1..54 | 15..68 | 281 | 100 | Plus |