Clone MIP06912 Report

Search the DGRC for MIP06912

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:69
Well:12
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43185-RC
Protein status:MIP06912.pep: gold
Sequenced Size:481

Clone Sequence Records

MIP06912.complete Sequence

481 bp assembled on 2009-03-10

GenBank Submission: BT072853.1

> MIP06912.complete
CGCTAAGTATCTACAGGCTGTGTAGTTCAACAAGAAACCCTTTTCTTTAA
AAATGTGCAATTGATAACTTAAGTCCCCTTTTTTACTCATAAAAATCAAT
ATATTTTTTATGACCCTAGCGACTGTGATGTGTTGTAAATTGATTTAATG
GCCAAATGCTCACTTTGAAGCTCGAGAGTGCGTTATAAACTGACATCGAA
TGAAGCCGGGCCCATTTACGCAAGTTGACTGTACAAACGCCATGCATTTG
AGACAACTCCTTACCGAAATGGTTATTATCTTGACCATATTGACCATTCC
TGGCTATACCATTCACACCTTGGCAGAGAAGAAAATCAGCCAATATCCTT
GGATCCCGAAGACGTCAACGCATATTACACCTTATAAGATATCTGGGGAT
ATATGAAATATGAAATGTGTTATTATGTATGAATAAATTTCGACGAATTT
GTCTGCCCAACAATAAAAAAAAAAAAAAAAA

MIP06912.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
DMG8-chr2L.11.009.d 549 DMG8-chr2L.11.009.d 45..509 1..465 2325 100 Plus
DMG8-chr2L.11.009.c 438 DMG8-chr2L.11.009.c 68..415 118..465 1740 100 Plus
DMG8-chr2L.11.009.a 484 DMG8-chr2L.11.009.a 99..444 120..465 1730 100 Plus
DMG8-chr2L.11.009.a 484 DMG8-chr2L.11.009.a 45..98 1..54 270 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5883983..5884254 1..272 1360 100 Plus
chr2L 23010047 chr2L 5884316..5884508 272..464 965 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:07:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5884932..5885203 1..272 1360 100 Plus
2L 23513712 2L 5885265..5885458 272..465 970 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5884932..5885203 1..272 1360 100 Plus
2L 23513712 2L 5885265..5885458 272..465 970 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:28:33 has no hits.

MIP06912.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:29:42 Download gff for MIP06912.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5883983..5884254 1..272 100 -> Plus
chr2L 5884317..5884508 273..464 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:41:37 Download gff for MIP06912.complete
Subject Subject Range Query Range Percent Splice Strand
CG43185-RB 1..207 200..406 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:35:46 Download gff for MIP06912.complete
Subject Subject Range Query Range Percent Splice Strand
CG43185-RC 1..165 242..406 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:41:37 Download gff for MIP06912.complete
Subject Subject Range Query Range Percent Splice Strand
CG43185-RA 1..464 1..464 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:35:46 Download gff for MIP06912.complete
Subject Subject Range Query Range Percent Splice Strand
CG43185-RC 1..464 1..464 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:29:42 Download gff for MIP06912.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5885266..5885457 273..464 100   Plus
2L 5884932..5885203 1..272 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:29:42 Download gff for MIP06912.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5885266..5885457 273..464 100   Plus
2L 5884932..5885203 1..272 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:29:42 Download gff for MIP06912.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5885266..5885457 273..464 100   Plus
2L 5884932..5885203 1..272 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:41:37 Download gff for MIP06912.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5884932..5885203 1..272 100 -> Plus
arm_2L 5885266..5885457 273..464 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:46 Download gff for MIP06912.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5884932..5885203 1..272 100 -> Plus
2L 5885266..5885457 273..464 100   Plus

MIP06912.pep Sequence

Translation from 199 to 405

> MIP06912.pep
MKPGPFTQVDCTNAMHLRQLLTEMVIILTILTIPGYTIHTLAEKKISQYP
WIPKTSTHITPYKISGDI*

MIP06912.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG43185-PD 54 CG43185-PD 1..54 15..68 281 100 Plus
CG43185-PC 54 CG43185-PC 1..54 15..68 281 100 Plus

MIP06912.hyp Sequence

Translation from 199 to 405

> MIP06912.hyp
MKPGPFTQVDCTNAMHLRQLLTEMVIILTILTIPGYTIHTLAEKKISQYP
WIPKTSTHITPYKISGDI*

MIP06912.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG43185-PD 54 CG43185-PD 1..54 15..68 281 100 Plus
CG43185-PC 54 CG43185-PC 1..54 15..68 281 100 Plus