Clone MIP06926 Report

Search the DGRC for MIP06926

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:69
Well:26
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptMf-RA
Protein status:MIP06926.pep: gold
Sequenced Size:905

Clone Sequence Records

MIP06926.complete Sequence

905 bp assembled on 2009-03-11

GenBank Submission: BT072881.1

> MIP06926.complete
AATCTCCGGAGCTTTGCCACACAGATGCGATGAAAATCGCTCACGGATAG
AGCAACCTACGCCGTAAAGGAATGCGCCGTGCTTTTGGTGCCGAAACGGA
ATGGCAAAATTCTGAAACGAGGAAAATTGCGAACGAGTTCAACGATTTTT
TCGTGAACAGAACAAAACAAATCGATCAAAATGTTCAAAAACCACTTGGA
AATGATTGGGCGCAATGAGAGCCCCAGCAAGAAGGCGAAATTCTGGCAGT
CCTACATCAGGTCCCTGAAGGGCTCCGAGGATATCCGTGCCCACGAGGCG
CCCCGTGCCTCTCGTCCCTACAGCTCCTACCTGGACTCGCCCTCCTACAG
GAGCATCTATGACGAGCCCGCCACCGCCAATGAGCGCGTCCAGTCCTCTG
GCTACAGATATCTGCCAGTGAGCCGCGACACATACGGCTACTCGCCCCGT
GCCATCTACGATCATCACTACAGCCGAACAAAGAAGGCCTGGAATGATCA
TCTGAAGCGCATGCAGGAGATCGAGCGCAGGTACCCATCTCGCTATGGTC
TCTACTTGAGGGACAAGCCACTCACGCCCAACTCGCTGGTGCCCCTGGAG
TACGAGCCAGAGGACAAGCTGCTGGCTGAGCTCAACAAGGCTATAAGAGT
TTGAAACGCTGAGCGTTAGTGAAAATAAATACTTTTGTTTGCTTAGCTCG
TAGTTAGACTCTTGTAAATTAACGCAAAATCTGTTCAACTTAAACGAAGT
GAAGGGATAAACGAAAATGAATTGTAATCAATATTTGTCTGTAAAAAGAA
ATCCCCGATAAGCAGCAATAGTCATATCGAGTGAAAATTTCGTTAAATGT
TTCATTGTATAATATATAAATATAAAATTGCAAAAAAAAAAAAAAAAAAA
AAAAA

MIP06926.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-RG 879 Mf-RG 1..879 1..879 4380 99.8 Plus
Mf.h 986 Mf.h 237..986 130..879 3735 99.8 Plus
Mf.d 2060 Mf.d 467..818 130..481 1745 99.7 Plus
Mf.d 2060 Mf.d 1318..1561 640..883 1205 99.5 Plus
Mf.d 2060 Mf.d 840..998 482..640 795 100 Plus
Mf.d 2060 Mf.d 253..381 1..129 645 100 Plus
Mf.h 986 Mf.h 23..151 1..129 645 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11000254..11000493 879..640 1185 99.6 Minus
chr3R 27901430 chr3R 11002908..11003118 481..271 1040 99.5 Minus
chr3R 27901430 chr3R 11003666..11003809 272..129 705 99.3 Minus
chr3R 27901430 chr3R 11004921..11005049 129..1 645 100 Minus
chr3R 27901430 chr3R 11000813..11000924 640..529 560 100 Minus
chr3R 27901430 chr3R 11000991..11001041 532..482 255 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:07:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15175621..15175864 883..640 1205 99.6 Minus
3R 32079331 3R 15178280..15178490 481..271 1040 99.5 Minus
3R 32079331 3R 15179038..15179181 272..129 720 100 Minus
3R 32079331 3R 15180293..15180421 129..1 645 100 Minus
3R 32079331 3R 15176184..15176295 640..529 560 100 Minus
3R 32079331 3R 15176362..15176412 532..482 255 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14916452..14916695 883..640 1205 99.5 Minus
3R 31820162 3R 14919111..14919321 481..271 1040 99.5 Minus
3R 31820162 3R 14919869..14920012 272..129 720 100 Minus
3R 31820162 3R 14921124..14921252 129..1 645 100 Minus
3R 31820162 3R 14917015..14917126 640..529 560 100 Minus
3R 31820162 3R 14917193..14917243 532..482 255 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:25:08 has no hits.

MIP06926.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:26:11 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11000279..11000492 641..854 99 <- Minus
chr3R 11000813..11000922 531..640 100 <- Minus
chr3R 11000993..11001041 482..530 100 <- Minus
chr3R 11002908..11003117 272..481 99 <- Minus
chr3R 11003667..11003808 130..271 99 <- Minus
chr3R 11004921..11005049 1..129 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:52:32 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RA 1..474 181..654 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:40:12 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RG 1..474 181..654 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:55:16 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RA 1..474 181..654 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:02:32 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RA 1..474 181..654 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-11 13:32:34 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RA 59..636 124..702 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:40:12 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RG 1..879 1..879 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:55:16 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RG 1..879 1..879 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:02:32 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RG 1..879 1..879 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:26:11 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15175623..15175863 641..881 99 <- Minus
3R 15176184..15176293 531..640 100 <- Minus
3R 15176364..15176412 482..530 100 <- Minus
3R 15178280..15178489 272..481 99 <- Minus
3R 15179039..15179180 130..271 100 <- Minus
3R 15180293..15180421 1..129 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:26:11 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15175623..15175863 641..881 99 <- Minus
3R 15176184..15176293 531..640 100 <- Minus
3R 15176364..15176412 482..530 100 <- Minus
3R 15178280..15178489 272..481 99 <- Minus
3R 15179039..15179180 130..271 100 <- Minus
3R 15180293..15180421 1..129 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:26:11 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15175623..15175863 641..881 99 <- Minus
3R 15176184..15176293 531..640 100 <- Minus
3R 15176364..15176412 482..530 100 <- Minus
3R 15178280..15178489 272..481 99 <- Minus
3R 15179039..15179180 130..271 100 <- Minus
3R 15180293..15180421 1..129 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:55:16 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11001345..11001585 641..881 99 <- Minus
arm_3R 11001906..11002015 531..640 100 <- Minus
arm_3R 11002086..11002134 482..530 100 <- Minus
arm_3R 11004002..11004211 272..481 99 <- Minus
arm_3R 11004761..11004902 130..271 100 <- Minus
arm_3R 11006015..11006143 1..129 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:14:27 Download gff for MIP06926.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14916454..14916694 641..881 99 <- Minus
3R 14917015..14917124 531..640 100 <- Minus
3R 14917195..14917243 482..530 100 <- Minus
3R 14919111..14919320 272..481 99 <- Minus
3R 14919870..14920011 130..271 100 <- Minus
3R 14921124..14921252 1..129 100   Minus

MIP06926.pep Sequence

Translation from 180 to 653

> MIP06926.pep
MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSY
LDSPSYRSIYDEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRT
KKAWNDHLKRMQEIERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAE
LNKAIRV*

MIP06926.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17159-PA 370 GF17159-PA 1..163 1..156 761 90.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20880-PA 365 GG20880-PA 1..163 1..156 777 93.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14549-PA 367 GH14549-PA 1..163 1..156 769 92 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-PN 157 CG6803-PN 1..157 1..157 835 100 Plus
Mf-PG 157 CG6803-PG 1..157 1..157 835 100 Plus
Mf-PA 157 CG6803-PA 1..157 1..157 835 100 Plus
Mf-PO 310 CG6803-PO 1..161 1..156 804 95.7 Plus
Mf-PE 166 CG6803-PE 1..163 1..156 802 94.5 Plus
Mf-PI 230 CG6803-PI 1..163 1..156 802 94.5 Plus
Mf-PH 236 CG6803-PH 1..163 1..156 802 94.5 Plus
Mf-PD 312 CG6803-PD 1..163 1..156 802 94.5 Plus
Mf-PJ 313 CG6803-PJ 1..163 1..156 802 94.5 Plus
Mf-PF 313 CG6803-PF 1..163 1..156 802 94.5 Plus
Mf-PM 364 CG6803-PM 1..163 1..156 802 94.5 Plus
Mf-PL 364 CG6803-PL 1..163 1..156 802 94.5 Plus
Mf-PB 365 CG6803-PB 1..163 1..156 802 94.5 Plus
Mf-PQ 168 CG6803-PQ 1..160 1..153 796 95 Plus
Mf-PC 168 CG6803-PC 1..160 1..153 796 95 Plus
Mf-PP 119 CG6803-PP 1..110 1..108 543 93.6 Plus
Mf-PK 119 CG6803-PK 1..110 1..108 543 93.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23663-PA 367 GI23663-PA 1..163 1..156 782 93.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21688-PA 367 GL21688-PA 1..163 1..156 768 92 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19873-PA 313 GA19873-PA 1..163 1..156 768 92 Plus
Dpse\GA19873-PC 312 GA19873-PC 1..163 1..156 768 92 Plus
Dpse\GA19873-PB 367 GA19873-PB 1..163 1..156 768 92 Plus
Dpse\GA19873-PD 168 GA19873-PD 1..161 1..154 764 91.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25804-PA 367 GM25804-PA 1..163 1..156 782 94.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20380-PA 236 GD20380-PA 1..163 1..156 782 94.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23223-PA 363 GJ23223-PA 1..163 1..156 769 92 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13979-PA 368 GK13979-PA 1..163 1..156 765 91.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26409-PA 313 GE26409-PA 1..163 1..156 774 93.3 Plus

MIP06926.hyp Sequence

Translation from 180 to 653

> MIP06926.hyp
MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSY
LDSPSYRSIYDEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRT
KKAWNDHLKRMQEIERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAE
LNKAIRV*

MIP06926.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-PN 157 CG6803-PN 1..157 1..157 835 100 Plus
Mf-PG 157 CG6803-PG 1..157 1..157 835 100 Plus
Mf-PA 157 CG6803-PA 1..157 1..157 835 100 Plus
Mf-PE 166 CG6803-PE 1..163 1..156 802 94.5 Plus
Mf-PQ 168 CG6803-PQ 1..160 1..153 796 95 Plus