Clone MIP07108 Report

Search the DGRC for MIP07108

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:71
Well:8
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42703-RA
Protein status:MIP07108.pep: gold
Sequenced Size:438

Clone Sequence Records

MIP07108.complete Sequence

438 bp assembled on 2009-03-10

GenBank Submission: BT072866.1

> MIP07108.complete
TAACCCATAATGTCGAATATACTTGCTGCCAAACTCGACTGCCAATGCGC
CGGAAAAAACAGTCCCATGGATTCGGTGATAGTGCCGATTACCCAGGAAC
TGAAGTGCATGCAAAAACTGGTCAAAAGGGTAAGACATTTTCAAATGGCC
AGGCTTTTCCAAAGCGAATCTGAGATGTACGCTGAAGAACTAAAGGCCCG
GAATCTTGCCATTTGGCGTGAACCTGATTATCGATACTGCAAGTGACCTT
TAAGGCAGTCACCACAGATTATAATACGTAAAGGATCGATCCCTTTTTAT
TAACGATATTCAATTTCAATTGCCCTTTGTACTTTTTAAAATTTTTCCAA
AACACTAGAATAGCCACAAAAAAAAAATGTATAAAGCAAATAAATGATGC
CTAAGAGTGTAGAAAAACAAAAAAAAAAAAAAAAAAAA

MIP07108.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
DMG8-chr2R.33.027.a 510 DMG8-chr2R.33.027.a 97..510 1..414 2070 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18987686..18988080 415..21 1915 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:52:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23101229..23101623 415..21 1975 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23102428..23102822 415..21 1975 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:52:08 has no hits.

MIP07108.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:53:12 Download gff for MIP07108.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18988139..18988158 1..20 100   Minus
chr2R 18987682..18988080 21..418 98 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:49 Download gff for MIP07108.complete
Subject Subject Range Query Range Percent Splice Strand
CG42703-RA 1..237 10..246 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:00 Download gff for MIP07108.complete
Subject Subject Range Query Range Percent Splice Strand
CG42703-RA 1..237 10..246 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:44:40 Download gff for MIP07108.complete
Subject Subject Range Query Range Percent Splice Strand
CG42703-RA 1..237 10..246 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:48 Download gff for MIP07108.complete
Subject Subject Range Query Range Percent Splice Strand
CG42703-RA 1..412 1..412 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:00 Download gff for MIP07108.complete
Subject Subject Range Query Range Percent Splice Strand
CG42703-RA 77..488 1..412 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:44:40 Download gff for MIP07108.complete
Subject Subject Range Query Range Percent Splice Strand
CG42703-RA 77..488 1..412 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:12 Download gff for MIP07108.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23101225..23101623 21..418 99 <- Minus
2R 23101682..23101701 1..20 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:12 Download gff for MIP07108.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23101225..23101623 21..418 99 <- Minus
2R 23101682..23101701 1..20 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:12 Download gff for MIP07108.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23101225..23101623 21..418 99 <- Minus
2R 23101682..23101701 1..20 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:00 Download gff for MIP07108.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18988748..18989146 21..418 99 <- Minus
arm_2R 18989205..18989224 1..20 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:59 Download gff for MIP07108.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23102442..23102840 21..418 99 <- Minus
2R 23102899..23102918 1..20 100   Minus

MIP07108.hyp Sequence

Translation from 9 to 245

> MIP07108.hyp
MSNILAAKLDCQCAGKNSPMDSVIVPITQELKCMQKLVKRVRHFQMARLF
QSESEMYAEELKARNLAIWREPDYRYCK*

MIP07108.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG42703-PA 78 CG42703-PA 1..78 1..78 409 100 Plus

MIP07108.pep Sequence

Translation from 9 to 245

> MIP07108.pep
MSNILAAKLDCQCAGKNSPMDSVIVPITQELKCMQKLVKRVRHFQMARLF
QSESEMYAEELKARNLAIWREPDYRYCK*

MIP07108.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG42703-PA 78 CG42703-PA 1..78 1..78 409 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25081-PA 78 GD25081-PA 1..78 1..78 369 88.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11605-PA 78 GE11605-PA 1..78 1..78 320 73.1 Plus