MIP07108.complete Sequence
438 bp assembled on 2009-03-10
GenBank Submission: BT072866.1
> MIP07108.complete
TAACCCATAATGTCGAATATACTTGCTGCCAAACTCGACTGCCAATGCGC
CGGAAAAAACAGTCCCATGGATTCGGTGATAGTGCCGATTACCCAGGAAC
TGAAGTGCATGCAAAAACTGGTCAAAAGGGTAAGACATTTTCAAATGGCC
AGGCTTTTCCAAAGCGAATCTGAGATGTACGCTGAAGAACTAAAGGCCCG
GAATCTTGCCATTTGGCGTGAACCTGATTATCGATACTGCAAGTGACCTT
TAAGGCAGTCACCACAGATTATAATACGTAAAGGATCGATCCCTTTTTAT
TAACGATATTCAATTTCAATTGCCCTTTGTACTTTTTAAAATTTTTCCAA
AACACTAGAATAGCCACAAAAAAAAAATGTATAAAGCAAATAAATGATGC
CTAAGAGTGTAGAAAAACAAAAAAAAAAAAAAAAAAAA
MIP07108.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:26:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
DMG8-chr2R.33.027.a | 510 | DMG8-chr2R.33.027.a | 97..510 | 1..414 | 2070 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:52:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 18987686..18988080 | 415..21 | 1915 | 99 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:52:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 23101229..23101623 | 415..21 | 1975 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 23102428..23102822 | 415..21 | 1975 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 19:52:08 has no hits.
MIP07108.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:53:12 Download gff for
MIP07108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 18988139..18988158 | 1..20 | 100 | | Minus |
chr2R | 18987682..18988080 | 21..418 | 98 | <- | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:49 Download gff for
MIP07108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42703-RA | 1..237 | 10..246 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:00 Download gff for
MIP07108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42703-RA | 1..237 | 10..246 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:44:40 Download gff for
MIP07108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42703-RA | 1..237 | 10..246 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:48 Download gff for
MIP07108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42703-RA | 1..412 | 1..412 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:00 Download gff for
MIP07108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42703-RA | 77..488 | 1..412 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:44:40 Download gff for
MIP07108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42703-RA | 77..488 | 1..412 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:12 Download gff for
MIP07108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23101225..23101623 | 21..418 | 99 | <- | Minus |
2R | 23101682..23101701 | 1..20 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:12 Download gff for
MIP07108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23101225..23101623 | 21..418 | 99 | <- | Minus |
2R | 23101682..23101701 | 1..20 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:12 Download gff for
MIP07108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23101225..23101623 | 21..418 | 99 | <- | Minus |
2R | 23101682..23101701 | 1..20 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:00 Download gff for
MIP07108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 18988748..18989146 | 21..418 | 99 | <- | Minus |
arm_2R | 18989205..18989224 | 1..20 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:59 Download gff for
MIP07108.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23102442..23102840 | 21..418 | 99 | <- | Minus |
2R | 23102899..23102918 | 1..20 | 100 | | Minus |
MIP07108.hyp Sequence
Translation from 9 to 245
> MIP07108.hyp
MSNILAAKLDCQCAGKNSPMDSVIVPITQELKCMQKLVKRVRHFQMARLF
QSESEMYAEELKARNLAIWREPDYRYCK*
MIP07108.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:43:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42703-PA | 78 | CG42703-PA | 1..78 | 1..78 | 409 | 100 | Plus |
MIP07108.pep Sequence
Translation from 9 to 245
> MIP07108.pep
MSNILAAKLDCQCAGKNSPMDSVIVPITQELKCMQKLVKRVRHFQMARLF
QSESEMYAEELKARNLAIWREPDYRYCK*
MIP07108.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42703-PA | 78 | CG42703-PA | 1..78 | 1..78 | 409 | 100 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:20:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD25081-PA | 78 | GD25081-PA | 1..78 | 1..78 | 369 | 88.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:20:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE11605-PA | 78 | GE11605-PA | 1..78 | 1..78 | 320 | 73.1 | Plus |