Clone MIP07141 Report

Search the DGRC for MIP07141

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:71
Well:41
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptSfp26Ac-RA
Protein status:MIP07141.pep: gold
Sequenced Size:338

Clone Sequence Records

MIP07141.complete Sequence

338 bp assembled on 2009-03-10

GenBank Submission: BT072869.1

> MIP07141.complete
AGTTTCGAAACTAAAGTGACGGCATGAAGATCCATCTCATATTTGTTATA
GTATCTCTGGTATTGGCGAAAACCATTGCAGACGAATGCCTTACCTGTGA
CTGGAAAAGTAATATCCATTGTGGAAAGGTTGCTGATGGCTCATGTGTGT
TTACTGCTCTGAATCGATGCCAAGTTGAAAGAATTTCATGCCGTCGAGAG
CAAAAAAAGCTGAAACCATTCACCGAAATTGTTAAAGGAAAGTGCCCTAA
GGACAAAGAAAAGTGCGCCAAGATGTAAAATAAAATCATGGTTCATTTCA
TCAATTAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP07141.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:32
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp26Ac-RA 332 Sfp26Ac-RA 25..332 1..308 1540 100 Plus
Sfp26Ac.a 671 Sfp26Ac.a 25..332 1..308 1540 100 Plus
DMG8-chr2L.11.009.c 438 DMG8-chr2L.11.009.c 1..69 163..95 345 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5883557..5883728 216..45 860 100 Minus
chr2L 23010047 chr2L 5883402..5883493 308..217 460 100 Minus
chr2L 23010047 chr2L 5883781..5883825 45..1 225 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5884506..5884677 216..45 860 100 Minus
2L 23513712 2L 5884351..5884442 308..217 460 100 Minus
2L 23513712 2L 5884730..5884774 45..1 225 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5884506..5884677 216..45 860 100 Minus
2L 23513712 2L 5884351..5884442 308..217 460 100 Minus
2L 23513712 2L 5884730..5884774 45..1 225 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:19:50 has no hits.

MIP07141.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:20:50 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5883401..5883493 217..309 98 <- Minus
chr2L 5883557..5883727 46..216 100 <- Minus
chr2L 5883781..5883825 1..45 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:52:21 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ac-RA 1..255 24..278 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:22 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ac-RA 1..255 24..278 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:55:09 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ac-RA 1..255 24..278 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:00:40 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ac-RA 1..255 24..278 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-10 14:34:54 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ac-RA 1..308 1..308 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:22 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ac-RA 1..308 1..308 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:55:09 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ac-RA 1..308 1..309 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:00:40 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp26Ac-RA 1..308 1..309 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:20:50 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5884350..5884442 217..309 98 <- Minus
2L 5884506..5884676 46..216 100 <- Minus
2L 5884730..5884774 1..45 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:20:50 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5884350..5884442 217..309 98 <- Minus
2L 5884506..5884676 46..216 100 <- Minus
2L 5884730..5884774 1..45 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:20:50 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5884350..5884442 217..309 98 <- Minus
2L 5884506..5884676 46..216 100 <- Minus
2L 5884730..5884774 1..45 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:55:09 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5884350..5884442 217..309 98 <- Minus
arm_2L 5884506..5884676 46..216 100 <- Minus
arm_2L 5884730..5884774 1..45 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:25 Download gff for MIP07141.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5884350..5884442 217..309 98 <- Minus
2L 5884506..5884676 46..216 100 <- Minus
2L 5884730..5884774 1..45 100   Minus

MIP07141.pep Sequence

Translation from 23 to 277

> MIP07141.pep
MKIHLIFVIVSLVLAKTIADECLTCDWKSNIHCGKVADGSCVFTALNRCQ
VERISCRREQKKLKPFTEIVKGKCPKDKEKCAKM*

MIP07141.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp26Ac-PA 84 CG42469-PA 1..84 1..84 451 100 Plus

MIP07141.hyp Sequence

Translation from 23 to 277

> MIP07141.hyp
MKIHLIFVIVSLVLAKTIADECLTCDWKSNIHCGKVADGSCVFTALNRCQ
VERISCRREQKKLKPFTEIVKGKCPKDKEKCAKM*

MIP07141.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp26Ac-PA 84 CG42469-PA 1..84 1..84 451 100 Plus