Clone MIP07161 Report

Search the DGRC for MIP07161

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:71
Well:61
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42615-RB
Protein status:MIP07161.pep: gold
Sequenced Size:453

Clone Sequence Records

MIP07161.complete Sequence

453 bp assembled on 2009-03-10

GenBank Submission: BT072871.1

> MIP07161.complete
ATTTTTCGATCCCGTCTCGTCGCCGATATATTCTACAGGCCCAGAGATAA
ACCGAAAAAAATGGACCACAAGAAAACGTTAACCTGGTTTTTCAGCCTGT
CATCGGTGCGCTACGCGCAGATCTTTATCGTAATGGCGGTCGATCTGCTG
ACCCTGTCCAATCTGTATCCCAAGCACTCGAGCTACATTGCGCGTCCATT
CCTACTCTGGCAGGATCTTCAGGAGGAGGACGAACGTAGCTTGGACTCAC
CCCAGCAATTCTAACTGATATATATATATTTTACCGTGCGTGGGAGACGT
TTTATTGCCCCCAAAGATTTTTGACCAGACACCAACCTTGAGTTTCAATG
CCAATGCCAGGCCCATGACGTCACTTGTATCTGCTTGCCTCTTGCTGGTT
GAATATACTGAATATTTTGTACATAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

MIP07161.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG42615-RB 421 CG42615-RB 1..421 4..424 2105 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4624920..4625340 4..424 2030 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8737370..8737791 4..425 2110 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8738569..8738990 4..425 2110 100 Plus
Blast to na_te.dros performed on 2019-03-16 20:21:10 has no hits.

MIP07161.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:22:02 Download gff for MIP07161.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4624919..4625340 1..424 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:41 Download gff for MIP07161.complete
Subject Subject Range Query Range Percent Splice Strand
CG42615-RB 1..204 61..264 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:06:13 Download gff for MIP07161.complete
Subject Subject Range Query Range Percent Splice Strand
CG42615-RB 1..204 61..264 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:00:03 Download gff for MIP07161.complete
Subject Subject Range Query Range Percent Splice Strand
CG42615-RB 1..204 61..264 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:41 Download gff for MIP07161.complete
Subject Subject Range Query Range Percent Splice Strand
CG42615-RB 1..421 4..424 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:06:13 Download gff for MIP07161.complete
Subject Subject Range Query Range Percent Splice Strand
CG42615-RB 1..421 4..424 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:00:03 Download gff for MIP07161.complete
Subject Subject Range Query Range Percent Splice Strand
CG42615-RB 1..421 4..424 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:22:02 Download gff for MIP07161.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8737369..8737790 1..424 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:22:02 Download gff for MIP07161.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8737369..8737790 1..424 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:22:02 Download gff for MIP07161.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8737369..8737790 1..424 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:06:13 Download gff for MIP07161.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4624874..4625295 1..424 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:13:49 Download gff for MIP07161.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8738568..8738989 1..424 99   Plus

MIP07161.pep Sequence

Translation from 0 to 263

> MIP07161.pep
IFRSRLVADIFYRPRDKPKKMDHKKTLTWFFSLSSVRYAQIFIVMAVDLL
TLSNLYPKHSSYIARPFLLWQDLQEEDERSLDSPQQF*

MIP07161.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12380-PA 90 GF12380-PA 1..60 21..80 194 63.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23383-PA 67 GG23383-PA 1..67 21..87 268 76.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG42615-PB 67 CG42615-PB 1..67 21..87 349 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21063-PA 54 GM21063-PA 1..54 21..74 250 92.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15379-PA 54 GD15379-PA 1..54 21..74 251 90.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19225-PA 67 GE19225-PA 1..67 21..87 303 85.1 Plus

MIP07161.hyp Sequence

Translation from 2 to 263

> MIP07161.hyp
FRSRLVADIFYRPRDKPKKMDHKKTLTWFFSLSSVRYAQIFIVMAVDLLT
LSNLYPKHSSYIARPFLLWQDLQEEDERSLDSPQQF*

MIP07161.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42615-PB 67 CG42615-PB 1..67 20..86 349 100 Plus