Clone MIP07212 Report

Search the DGRC for MIP07212

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:72
Well:12
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43183-RA
Protein status:MIP07212.pep: gold
Sequenced Size:573

Clone Sequence Records

MIP07212.complete Sequence

573 bp assembled on 2009-03-17

GenBank Submission: BT072911.1

> MIP07212.complete
CTCAGATACTCAAATACTAATACCCTGATAGCAAATAGCCACAAATAGAC
ACACTACCACATTTGCACCATGATATATCTACAGAGTTGCTGCTGCTGCG
TGGATCTGCGAATCGGAACCATAGCAATAGGGATTTTGCACATTATAGCG
GATATCCTTGGAGGCACATTTGTTGCTTTATTTGGGGAGTCGGGTATTCC
CGATTTGGGTCACACCCTATTCATTATCTTCGTTATGCTGCACATCCTGA
GCTGCGTTTTCCTGATCATCGGCAGTATACGGTTACGGAGCAGCTGGATG
CTCTTCTACATAATAATGACTATGATCATGGCGGTAGCAATGCTCATATT
GATAGTATCCGACGTCATACTCGCCGTTTGTTTCTGGGTAATGATCACGT
ATGCTATAATGTTCTTTATTTGCCTTTATTCCTGGCTAGTGGCGTACTCT
TTTTACGCCGCCTTAGGAGGACCTCTCTTCATCTGAATGTGATCCATTGC
CAAGTAATAAATTGTACTGTGATTGTAGCAATAAAGTACTTGAATTTTTA
CAAAAAAAAAAAAAAAAAAAAAA

MIP07212.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
DMG4-MB6.chr2R.8.009.a 535 DMG4-MB6.chr2R.8.009.a 1..535 1..535 2675 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4479838..4480033 1..196 980 100 Plus
chr2R 21145070 chr2R 4480420..4480555 416..551 680 100 Plus
chr2R 21145070 chr2R 4480227..4480360 282..415 670 100 Plus
chr2R 21145070 chr2R 4480081..4480170 193..282 450 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8592252..8592447 1..196 980 100 Plus
2R 25286936 2R 8592834..8592972 416..554 695 100 Plus
2R 25286936 2R 8592641..8592774 282..415 670 100 Plus
2R 25286936 2R 8592495..8592584 193..282 450 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8593451..8593646 1..196 980 100 Plus
2R 25260384 2R 8594033..8594171 416..554 695 100 Plus
2R 25260384 2R 8593840..8593973 282..415 670 100 Plus
2R 25260384 2R 8593694..8593783 193..282 450 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:51:52 has no hits.

MIP07212.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:52:56 Download gff for MIP07212.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4479838..4480030 1..193 100 -> Plus
chr2R 4480082..4480170 194..282 100 -> Plus
chr2R 4480228..4480360 283..415 100 -> Plus
chr2R 4480420..4480555 416..551 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:40:16 Download gff for MIP07212.complete
Subject Subject Range Query Range Percent Splice Strand
CG43183-RA 1..417 70..486 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:42:19 Download gff for MIP07212.complete
Subject Subject Range Query Range Percent Splice Strand
CG43183-RA 1..417 70..486 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:40:16 Download gff for MIP07212.complete
Subject Subject Range Query Range Percent Splice Strand
CG43183-RA 58..608 1..551 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:42:19 Download gff for MIP07212.complete
Subject Subject Range Query Range Percent Splice Strand
CG43183-RA 58..608 1..551 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:52:56 Download gff for MIP07212.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8592834..8592969 416..551 100   Plus
2R 8592252..8592444 1..193 100 -> Plus
2R 8592496..8592584 194..282 100 -> Plus
2R 8592642..8592774 283..415 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:52:56 Download gff for MIP07212.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8592834..8592969 416..551 100   Plus
2R 8592252..8592444 1..193 100 -> Plus
2R 8592496..8592584 194..282 100 -> Plus
2R 8592642..8592774 283..415 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:52:56 Download gff for MIP07212.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8592834..8592969 416..551 100   Plus
2R 8592252..8592444 1..193 100 -> Plus
2R 8592496..8592584 194..282 100 -> Plus
2R 8592642..8592774 283..415 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:40:16 Download gff for MIP07212.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4479757..4479949 1..193 100 -> Plus
arm_2R 4480001..4480089 194..282 100 -> Plus
arm_2R 4480147..4480279 283..415 100 -> Plus
arm_2R 4480339..4480474 416..551 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:15:12 Download gff for MIP07212.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8593451..8593643 1..193 100 -> Plus
2R 8593695..8593783 194..282 100 -> Plus
2R 8593841..8593973 283..415 100 -> Plus
2R 8594033..8594168 416..551 100   Plus

MIP07212.pep Sequence

Translation from 69 to 485

> MIP07212.pep
MIYLQSCCCCVDLRIGTIAIGILHIIADILGGTFVALFGESGIPDLGHTL
FIIFVMLHILSCVFLIIGSIRLRSSWMLFYIIMTMIMAVAMLILIVSDVI
LAVCFWVMITYAIMFFICLYSWLVAYSFYAALGGPLFI*

MIP07212.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13102-PA 141 GF13102-PA 1..135 1..135 351 56.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23368-PA 138 GG23368-PA 1..138 1..138 610 90.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22907-PA 138 GH22907-PA 1..138 1..138 339 55.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG43183-PA 138 CG43183-PA 1..138 1..138 713 100 Plus
CG34230-PA 129 CG34230-PA 1..126 1..132 148 27.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18392-PA 71 GI18392-PA 4..71 71..138 138 60.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18443-PA 149 GL18443-PA 1..116 1..116 279 49.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25071-PB 138 GA25071-PB 1..138 1..138 360 54.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21047-PA 138 GM21047-PA 1..138 1..138 642 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10578-PA 138 GD10578-PA 1..138 1..138 633 94.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21469-PA 72 GJ21469-PA 1..71 1..71 201 56.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17887-PA 117 GK17887-PA 1..114 1..114 265 55.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19211-PA 84 GE19211-PA 1..73 1..73 330 93.2 Plus

MIP07212.hyp Sequence

Translation from 69 to 485

> MIP07212.hyp
MIYLQSCCCCVDLRIGTIAIGILHIIADILGGTFVALFGESGIPDLGHTL
FIIFVMLHILSCVFLIIGSIRLRSSWMLFYIIMTMIMAVAMLILIVSDVI
LAVCFWVMITYAIMFFICLYSWLVAYSFYAALGGPLFI*

MIP07212.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG43183-PA 138 CG43183-PA 1..138 1..138 713 100 Plus
CG34230-PA 129 CG34230-PA 1..126 1..132 148 27.4 Plus