BDGP Sequence Production Resources |
Search the DGRC for MIP07212
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 72 |
Well: | 12 |
Vector: | pOT2|pOTB7_DraIII |
Associated Gene/Transcript | CG43183-RA |
Protein status: | MIP07212.pep: gold |
Sequenced Size: | 573 |
573 bp assembled on 2009-03-17
GenBank Submission: BT072911.1
> MIP07212.complete CTCAGATACTCAAATACTAATACCCTGATAGCAAATAGCCACAAATAGAC ACACTACCACATTTGCACCATGATATATCTACAGAGTTGCTGCTGCTGCG TGGATCTGCGAATCGGAACCATAGCAATAGGGATTTTGCACATTATAGCG GATATCCTTGGAGGCACATTTGTTGCTTTATTTGGGGAGTCGGGTATTCC CGATTTGGGTCACACCCTATTCATTATCTTCGTTATGCTGCACATCCTGA GCTGCGTTTTCCTGATCATCGGCAGTATACGGTTACGGAGCAGCTGGATG CTCTTCTACATAATAATGACTATGATCATGGCGGTAGCAATGCTCATATT GATAGTATCCGACGTCATACTCGCCGTTTGTTTCTGGGTAATGATCACGT ATGCTATAATGTTCTTTATTTGCCTTTATTCCTGGCTAGTGGCGTACTCT TTTTACGCCGCCTTAGGAGGACCTCTCTTCATCTGAATGTGATCCATTGC CAAGTAATAAATTGTACTGTGATTGTAGCAATAAAGTACTTGAATTTTTA CAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
DMG4-MB6.chr2R.8.009.a | 535 | DMG4-MB6.chr2R.8.009.a | 1..535 | 1..535 | 2675 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 4479838..4480033 | 1..196 | 980 | 100 | Plus |
chr2R | 21145070 | chr2R | 4480420..4480555 | 416..551 | 680 | 100 | Plus |
chr2R | 21145070 | chr2R | 4480227..4480360 | 282..415 | 670 | 100 | Plus |
chr2R | 21145070 | chr2R | 4480081..4480170 | 193..282 | 450 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 8592252..8592447 | 1..196 | 980 | 100 | Plus |
2R | 25286936 | 2R | 8592834..8592972 | 416..554 | 695 | 100 | Plus |
2R | 25286936 | 2R | 8592641..8592774 | 282..415 | 670 | 100 | Plus |
2R | 25286936 | 2R | 8592495..8592584 | 193..282 | 450 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 8593451..8593646 | 1..196 | 980 | 100 | Plus |
2R | 25260384 | 2R | 8594033..8594171 | 416..554 | 695 | 100 | Plus |
2R | 25260384 | 2R | 8593840..8593973 | 282..415 | 670 | 100 | Plus |
2R | 25260384 | 2R | 8593694..8593783 | 193..282 | 450 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 4479838..4480030 | 1..193 | 100 | -> | Plus |
chr2R | 4480082..4480170 | 194..282 | 100 | -> | Plus |
chr2R | 4480228..4480360 | 283..415 | 100 | -> | Plus |
chr2R | 4480420..4480555 | 416..551 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG43183-RA | 1..417 | 70..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG43183-RA | 1..417 | 70..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG43183-RA | 58..608 | 1..551 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG43183-RA | 58..608 | 1..551 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8592834..8592969 | 416..551 | 100 | Plus | |
2R | 8592252..8592444 | 1..193 | 100 | -> | Plus |
2R | 8592496..8592584 | 194..282 | 100 | -> | Plus |
2R | 8592642..8592774 | 283..415 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8592834..8592969 | 416..551 | 100 | Plus | |
2R | 8592252..8592444 | 1..193 | 100 | -> | Plus |
2R | 8592496..8592584 | 194..282 | 100 | -> | Plus |
2R | 8592642..8592774 | 283..415 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8592834..8592969 | 416..551 | 100 | Plus | |
2R | 8592252..8592444 | 1..193 | 100 | -> | Plus |
2R | 8592496..8592584 | 194..282 | 100 | -> | Plus |
2R | 8592642..8592774 | 283..415 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 4479757..4479949 | 1..193 | 100 | -> | Plus |
arm_2R | 4480001..4480089 | 194..282 | 100 | -> | Plus |
arm_2R | 4480147..4480279 | 283..415 | 100 | -> | Plus |
arm_2R | 4480339..4480474 | 416..551 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 8593451..8593643 | 1..193 | 100 | -> | Plus |
2R | 8593695..8593783 | 194..282 | 100 | -> | Plus |
2R | 8593841..8593973 | 283..415 | 100 | -> | Plus |
2R | 8594033..8594168 | 416..551 | 100 | Plus |
Translation from 69 to 485
> MIP07212.pep MIYLQSCCCCVDLRIGTIAIGILHIIADILGGTFVALFGESGIPDLGHTL FIIFVMLHILSCVFLIIGSIRLRSSWMLFYIIMTMIMAVAMLILIVSDVI LAVCFWVMITYAIMFFICLYSWLVAYSFYAALGGPLFI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13102-PA | 141 | GF13102-PA | 1..135 | 1..135 | 351 | 56.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23368-PA | 138 | GG23368-PA | 1..138 | 1..138 | 610 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22907-PA | 138 | GH22907-PA | 1..138 | 1..138 | 339 | 55.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG43183-PA | 138 | CG43183-PA | 1..138 | 1..138 | 713 | 100 | Plus |
CG34230-PA | 129 | CG34230-PA | 1..126 | 1..132 | 148 | 27.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18392-PA | 71 | GI18392-PA | 4..71 | 71..138 | 138 | 60.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18443-PA | 149 | GL18443-PA | 1..116 | 1..116 | 279 | 49.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25071-PB | 138 | GA25071-PB | 1..138 | 1..138 | 360 | 54.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21047-PA | 138 | GM21047-PA | 1..138 | 1..138 | 642 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10578-PA | 138 | GD10578-PA | 1..138 | 1..138 | 633 | 94.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21469-PA | 72 | GJ21469-PA | 1..71 | 1..71 | 201 | 56.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17887-PA | 117 | GK17887-PA | 1..114 | 1..114 | 265 | 55.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19211-PA | 84 | GE19211-PA | 1..73 | 1..73 | 330 | 93.2 | Plus |
Translation from 69 to 485
> MIP07212.hyp MIYLQSCCCCVDLRIGTIAIGILHIIADILGGTFVALFGESGIPDLGHTL FIIFVMLHILSCVFLIIGSIRLRSSWMLFYIIMTMIMAVAMLILIVSDVI LAVCFWVMITYAIMFFICLYSWLVAYSFYAALGGPLFI*