MIP07237.complete Sequence
335 bp assembled on 2011-03-07
GenBank Submission: BT126152.1
> MIP07237.complete
TTGAGTGCCGAGGCAGCCGAGAGAAATGTTGTTACAATCGATATTAATGA
AAATATTGGCCGTTTTTTTGGTCTGCTGGCTGGGACACGTCACAGCCCAG
TCATCTGCCGATTATATAGAGCTTGAAATTGGTTCAAGGGGTGAAGGTCC
ACCGGAAAAGACGGAATTTCCCTGGGGCAATGATGACCAGGATCTTGAAG
CAACATTTTAAGTTTCTTAAGATTTTTTAAATTCTATAAATTGCATCATA
TACATCTCTGTTAAATATATTATAAAGAGAATCCAAGTCTTATCAGTAAA
GTTACTTGTTATAACCAAAAAAAAAAAAAAAAAAA
MIP07237.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 14751956..14752193 | 316..79 | 1190 | 100 | Minus |
chr2R | 21145070 | chr2R | 14752277..14752355 | 79..1 | 395 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18864815..18865056 | 320..79 | 1210 | 100 | Minus |
2R | 25286936 | 2R | 18865140..18865218 | 79..1 | 395 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 18866014..18866255 | 320..79 | 1210 | 100 | Minus |
2R | 25260384 | 2R | 18866339..18866417 | 79..1 | 395 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 22:20:00 has no hits.
MIP07237.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:04 Download gff for
MIP07237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 14751956..14752192 | 80..316 | 100 | <- | Minus |
chr2R | 14752277..14752355 | 1..79 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-09 09:22:34 Download gff for
MIP07237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43071-RA | 1..165 | 47..211 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:30 Download gff for
MIP07237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43071-RB | 1..186 | 26..211 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:26:57 Download gff for
MIP07237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43071-RB | 1..186 | 26..211 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:22:34 Download gff for
MIP07237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43071-RA | 1..165 | 47..211 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:30 Download gff for
MIP07237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43071-RB | 1..316 | 1..316 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:57 Download gff for
MIP07237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43071-RB | 1..316 | 1..316 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:04 Download gff for
MIP07237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18864819..18865055 | 80..316 | 100 | <- | Minus |
2R | 18865140..18865218 | 1..79 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:04 Download gff for
MIP07237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18864819..18865055 | 80..316 | 100 | <- | Minus |
2R | 18865140..18865218 | 1..79 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:04 Download gff for
MIP07237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18864819..18865055 | 80..316 | 100 | <- | Minus |
2R | 18865140..18865218 | 1..79 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:30 Download gff for
MIP07237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14752324..14752560 | 80..316 | 100 | <- | Minus |
arm_2R | 14752645..14752723 | 1..79 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:38 Download gff for
MIP07237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18866018..18866254 | 80..316 | 100 | <- | Minus |
2R | 18866339..18866417 | 1..79 | 100 | | Minus |
MIP07237.hyp Sequence
Translation from 25 to 210
> MIP07237.hyp
MLLQSILMKILAVFLVCWLGHVTAQSSADYIELEIGSRGEGPPEKTEFPW
GNDDQDLEATF*
MIP07237.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43071-PC | 61 | CG43071-PC | 1..61 | 1..61 | 322 | 100 | Plus |
CG43071-PB | 61 | CG43071-PB | 1..61 | 1..61 | 322 | 100 | Plus |
MIP07237.pep Sequence
Translation from 25 to 210
> MIP07237.pep
MLLQSILMKILAVFLVCWLGHVTAQSSADYIELEIGSRGEGPPEKTEFPW
GNDDQDLEATF*
MIP07237.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:27:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF13740-PA | 64 | GF13740-PA | 1..53 | 1..55 | 144 | 56.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43071-PC | 61 | CG43071-PC | 1..61 | 1..61 | 322 | 100 | Plus |
CG43071-PB | 61 | CG43071-PB | 1..61 | 1..61 | 322 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:27:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL10578-PA | 64 | GL10578-PA | 1..54 | 1..55 | 126 | 50.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:27:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13870-PA | 54 | GE13870-PA | 1..54 | 8..61 | 275 | 92.6 | Plus |