Clone MIP07237 Report

Search the DGRC for MIP07237

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:72
Well:37
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43071-RB
Protein status:MIP07237.pep: gold
Sequenced Size:335

Clone Sequence Records

MIP07237.complete Sequence

335 bp assembled on 2011-03-07

GenBank Submission: BT126152.1

> MIP07237.complete
TTGAGTGCCGAGGCAGCCGAGAGAAATGTTGTTACAATCGATATTAATGA
AAATATTGGCCGTTTTTTTGGTCTGCTGGCTGGGACACGTCACAGCCCAG
TCATCTGCCGATTATATAGAGCTTGAAATTGGTTCAAGGGGTGAAGGTCC
ACCGGAAAAGACGGAATTTCCCTGGGGCAATGATGACCAGGATCTTGAAG
CAACATTTTAAGTTTCTTAAGATTTTTTAAATTCTATAAATTGCATCATA
TACATCTCTGTTAAATATATTATAAAGAGAATCCAAGTCTTATCAGTAAA
GTTACTTGTTATAACCAAAAAAAAAAAAAAAAAAA

MIP07237.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14751956..14752193 316..79 1190 100 Minus
chr2R 21145070 chr2R 14752277..14752355 79..1 395 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18864815..18865056 320..79 1210 100 Minus
2R 25286936 2R 18865140..18865218 79..1 395 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18866014..18866255 320..79 1210 100 Minus
2R 25260384 2R 18866339..18866417 79..1 395 100 Minus
Blast to na_te.dros performed on 2019-03-16 22:20:00 has no hits.

MIP07237.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:04 Download gff for MIP07237.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14751956..14752192 80..316 100 <- Minus
chr2R 14752277..14752355 1..79 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-09 09:22:34 Download gff for MIP07237.complete
Subject Subject Range Query Range Percent Splice Strand
CG43071-RA 1..165 47..211 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:30 Download gff for MIP07237.complete
Subject Subject Range Query Range Percent Splice Strand
CG43071-RB 1..186 26..211 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:26:57 Download gff for MIP07237.complete
Subject Subject Range Query Range Percent Splice Strand
CG43071-RB 1..186 26..211 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:22:34 Download gff for MIP07237.complete
Subject Subject Range Query Range Percent Splice Strand
CG43071-RA 1..165 47..211 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:30 Download gff for MIP07237.complete
Subject Subject Range Query Range Percent Splice Strand
CG43071-RB 1..316 1..316 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:57 Download gff for MIP07237.complete
Subject Subject Range Query Range Percent Splice Strand
CG43071-RB 1..316 1..316 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:04 Download gff for MIP07237.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18864819..18865055 80..316 100 <- Minus
2R 18865140..18865218 1..79 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:04 Download gff for MIP07237.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18864819..18865055 80..316 100 <- Minus
2R 18865140..18865218 1..79 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:04 Download gff for MIP07237.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18864819..18865055 80..316 100 <- Minus
2R 18865140..18865218 1..79 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:30 Download gff for MIP07237.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14752324..14752560 80..316 100 <- Minus
arm_2R 14752645..14752723 1..79 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:38 Download gff for MIP07237.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18866018..18866254 80..316 100 <- Minus
2R 18866339..18866417 1..79 100   Minus

MIP07237.hyp Sequence

Translation from 25 to 210

> MIP07237.hyp
MLLQSILMKILAVFLVCWLGHVTAQSSADYIELEIGSRGEGPPEKTEFPW
GNDDQDLEATF*

MIP07237.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG43071-PC 61 CG43071-PC 1..61 1..61 322 100 Plus
CG43071-PB 61 CG43071-PB 1..61 1..61 322 100 Plus

MIP07237.pep Sequence

Translation from 25 to 210

> MIP07237.pep
MLLQSILMKILAVFLVCWLGHVTAQSSADYIELEIGSRGEGPPEKTEFPW
GNDDQDLEATF*

MIP07237.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13740-PA 64 GF13740-PA 1..53 1..55 144 56.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG43071-PC 61 CG43071-PC 1..61 1..61 322 100 Plus
CG43071-PB 61 CG43071-PB 1..61 1..61 322 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10578-PA 64 GL10578-PA 1..54 1..55 126 50.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13870-PA 54 GE13870-PA 1..54 8..61 275 92.6 Plus