Clone MIP07248 Report

Search the DGRC for MIP07248

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:72
Well:48
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43109-RA
Protein status:MIP07248.pep: gold
Sequenced Size:322

Clone Sequence Records

MIP07248.complete Sequence

322 bp assembled on 2009-03-17

GenBank Submission: BT072916.1

> MIP07248.complete
CTTCTCCCGGTGAAATGTGGCTTCTCTGGTTTATTCTCCACCTAATTGGC
CTCATCCAAGGGCGTTCTGTGGGCGGTGGGTCTGTAAACTTGGATGACGA
GTTTTTCATGCCTCAGCCAGATCCCACAATATTTGCCTACAATCAAACTG
ATAAGGGATCATCACCCTGGGACAATACCTGGAACTGAATACTTGTAAAA
AAAAAAGTGACTTGTAATTGTAATAAATTTATTTTATTTAATAAAAATTA
TGTAGCTTCTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

MIP07248.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
DMG8-chr2R.27.007.a 324 DMG8-chr2R.27.007.a 64..324 1..261 1305 100 Plus
DptB-RA 480 DptB-RA 431..480 263..214 250 100 Minus
DptB.a 717 DptB.a 668..717 263..214 250 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14754986..14755147 261..100 795 99.4 Minus
chr2R 21145070 chr2R 14755205..14755305 101..1 505 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18867846..18868009 263..100 820 100 Minus
2R 25286936 2R 18868067..18868167 101..1 505 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18869045..18869208 263..100 820 100 Minus
2R 25260384 2R 18869266..18869366 101..1 505 100 Minus
Blast to na_te.dros performed 2019-03-16 05:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 33..104 189..259 132 66.7 Plus
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 326..382 198..250 122 73.7 Plus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 4270..4338 261..193 111 62.3 Minus
Bari1 1728 Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). 314..342 222..250 109 86.2 Plus
G7 1192 G7 G7 1192bp 1141..1179 251..212 107 77.5 Minus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1016..1092 174..249 103 61 Plus

MIP07248.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:06:58 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14755028..14755145 102..219 100 <- Minus
chr2R 14755205..14755305 1..101 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:40:59 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
CG43109-RA 1..174 15..188 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:31 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
CG43109-RA 1..174 15..188 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:57:28 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
CG43109-RA 1..174 15..188 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-17 18:44:33 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
DptB-RA 403..452 212..261 100   Minus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:40:59 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
CG43109-RA 1..261 1..261 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:31 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
CG43109-RA 1..261 1..261 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:57:28 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
CG43109-RA 1..261 1..261 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:58 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18867848..18868007 102..261 100 <- Minus
2R 18868067..18868167 1..101 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:58 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18867848..18868007 102..261 100 <- Minus
2R 18868067..18868167 1..101 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:58 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18867848..18868007 102..261 100 <- Minus
2R 18868067..18868167 1..101 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:31 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14755353..14755512 102..261 100 <- Minus
arm_2R 14755572..14755672 1..101 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:15:24 Download gff for MIP07248.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18869047..18869206 102..261 100 <- Minus
2R 18869266..18869366 1..101 100   Minus

MIP07248.hyp Sequence

Translation from 2 to 187

> MIP07248.hyp
SPGEMWLLWFILHLIGLIQGRSVGGGSVNLDDEFFMPQPDPTIFAYNQTD
KGSSPWDNTWN*

MIP07248.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG43109-PA 57 CG43109-PA 1..57 5..61 324 100 Plus

MIP07248.pep Sequence

Translation from 2 to 187

> MIP07248.pep
SPGEMWLLWFILHLIGLIQGRSVGGGSVNLDDEFFMPQPDPTIFAYNQTD
KGSSPWDNTWN*

MIP07248.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG43109-PA 57 CG43109-PA 1..57 5..61 324 100 Plus