MIP07248.complete Sequence
322 bp assembled on 2009-03-17
GenBank Submission: BT072916.1
> MIP07248.complete
CTTCTCCCGGTGAAATGTGGCTTCTCTGGTTTATTCTCCACCTAATTGGC
CTCATCCAAGGGCGTTCTGTGGGCGGTGGGTCTGTAAACTTGGATGACGA
GTTTTTCATGCCTCAGCCAGATCCCACAATATTTGCCTACAATCAAACTG
ATAAGGGATCATCACCCTGGGACAATACCTGGAACTGAATACTTGTAAAA
AAAAAAGTGACTTGTAATTGTAATAAATTTATTTTATTTAATAAAAATTA
TGTAGCTTCTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA
MIP07248.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:27:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
DMG8-chr2R.27.007.a | 324 | DMG8-chr2R.27.007.a | 64..324 | 1..261 | 1305 | 100 | Plus |
DptB-RA | 480 | DptB-RA | 431..480 | 263..214 | 250 | 100 | Minus |
DptB.a | 717 | DptB.a | 668..717 | 263..214 | 250 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:06:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 14754986..14755147 | 261..100 | 795 | 99.4 | Minus |
chr2R | 21145070 | chr2R | 14755205..14755305 | 101..1 | 505 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18867846..18868009 | 263..100 | 820 | 100 | Minus |
2R | 25286936 | 2R | 18868067..18868167 | 101..1 | 505 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:44:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 18869045..18869208 | 263..100 | 820 | 100 | Minus |
2R | 25260384 | 2R | 18869266..18869366 | 101..1 | 505 | 100 | Minus |
Blast to na_te.dros performed 2019-03-16 05:06:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TAHRE | 10463 | TAHRE OSV 10463bp | 33..104 | 189..259 | 132 | 66.7 | Plus |
HeT-A | 6083 | HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). | 326..382 | 198..250 | 122 | 73.7 | Plus |
17.6 | 7439 | 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). | 4270..4338 | 261..193 | 111 | 62.3 | Minus |
Bari1 | 1728 | Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). | 314..342 | 222..250 | 109 | 86.2 | Plus |
G7 | 1192 | G7 G7 1192bp | 1141..1179 | 251..212 | 107 | 77.5 | Minus |
Max-element | 8556 | Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). | 1016..1092 | 174..249 | 103 | 61 | Plus |
MIP07248.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:06:58 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 14755028..14755145 | 102..219 | 100 | <- | Minus |
chr2R | 14755205..14755305 | 1..101 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:40:59 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43109-RA | 1..174 | 15..188 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:31 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43109-RA | 1..174 | 15..188 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:57:28 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43109-RA | 1..174 | 15..188 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-17 18:44:33 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
DptB-RA | 403..452 | 212..261 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:40:59 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43109-RA | 1..261 | 1..261 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:31 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43109-RA | 1..261 | 1..261 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:57:28 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43109-RA | 1..261 | 1..261 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:58 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18867848..18868007 | 102..261 | 100 | <- | Minus |
2R | 18868067..18868167 | 1..101 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:58 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18867848..18868007 | 102..261 | 100 | <- | Minus |
2R | 18868067..18868167 | 1..101 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:58 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18867848..18868007 | 102..261 | 100 | <- | Minus |
2R | 18868067..18868167 | 1..101 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:31 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14755353..14755512 | 102..261 | 100 | <- | Minus |
arm_2R | 14755572..14755672 | 1..101 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:15:24 Download gff for
MIP07248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18869047..18869206 | 102..261 | 100 | <- | Minus |
2R | 18869266..18869366 | 1..101 | 100 | | Minus |
MIP07248.hyp Sequence
Translation from 2 to 187
> MIP07248.hyp
SPGEMWLLWFILHLIGLIQGRSVGGGSVNLDDEFFMPQPDPTIFAYNQTD
KGSSPWDNTWN*
MIP07248.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:09:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43109-PA | 57 | CG43109-PA | 1..57 | 5..61 | 324 | 100 | Plus |
MIP07248.pep Sequence
Translation from 2 to 187
> MIP07248.pep
SPGEMWLLWFILHLIGLIQGRSVGGGSVNLDDEFFMPQPDPTIFAYNQTD
KGSSPWDNTWN*
MIP07248.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43109-PA | 57 | CG43109-PA | 1..57 | 5..61 | 324 | 100 | Plus |