MIP08441.complete Sequence
276 bp assembled on 2009-03-14
GenBank Submission: BT072907.1
> MIP08441.complete
AGTTTATTGGGAGAATTCAAATAGTTAGCACCGGTATGAAAGTCTTCGGA
ACTATTCTTATGTTGGCAATTTTAGCCCTAGATGTGTGCAATGCAGTAAA
ATGTGTTTTAACTTGTCGTACATCGGCTGGCGACTACGAAGTCATTGAGA
TATAAGTTGTGTGCAATCTTTAAAACTATAAACTATAGATTCGCTTTAAC
GGAGCTTAAAATGAATGTTGGATAATTCTGCAATAAAATATATACTGGAT
TCAAAAAAAAAAAAAAAAAAAAAAAA
MIP08441.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:27:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
DMG8-chr3L.36.005.a | 412 | DMG8-chr3L.36.005.a | 27..282 | 1..256 | 1265 | 99.6 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:47:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 20748028..20748213 | 66..251 | 915 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 20747903..20747968 | 1..66 | 330 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:09:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:47:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 20759006..20759196 | 66..256 | 940 | 99.5 | Plus |
3L | 28110227 | 3L | 20758881..20758946 | 1..66 | 330 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 20752106..20752296 | 66..256 | 940 | 99.4 | Plus |
3L | 28103327 | 3L | 20751981..20752046 | 1..66 | 330 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 21:47:57 has no hits.
MIP08441.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:48:55 Download gff for
MIP08441.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 20747903..20747968 | 1..66 | 100 | -> | Plus |
chr3L | 20748029..20748213 | 67..252 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:02:58 Download gff for
MIP08441.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43251-RA | 1..120 | 36..155 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:38 Download gff for
MIP08441.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43251-RA | 1..120 | 36..155 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:02:58 Download gff for
MIP08441.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43251-RA | 1..249 | 3..252 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:38 Download gff for
MIP08441.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43251-RA | 1..249 | 3..252 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:48:55 Download gff for
MIP08441.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 20758881..20758946 | 1..66 | 100 | -> | Plus |
3L | 20759007..20759191 | 67..252 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:48:55 Download gff for
MIP08441.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 20758881..20758946 | 1..66 | 100 | -> | Plus |
3L | 20759007..20759191 | 67..252 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:48:55 Download gff for
MIP08441.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 20758881..20758946 | 1..66 | 100 | -> | Plus |
3L | 20759007..20759191 | 67..252 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:02:58 Download gff for
MIP08441.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 20751981..20752046 | 1..66 | 100 | -> | Plus |
arm_3L | 20752107..20752291 | 67..252 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:14:58 Download gff for
MIP08441.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 20751981..20752046 | 1..66 | 100 | -> | Plus |
3L | 20752107..20752291 | 67..252 | 99 | | Plus |
MIP08441.pep Sequence
Translation from 2 to 154
> MIP08441.pep
FIGRIQIVSTGMKVFGTILMLAILALDVCNAVKCVLTCRTSAGDYEVIEI
*
MIP08441.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43251-PA | 39 | CG43251-PA | 1..39 | 12..50 | 196 | 100 | Plus |
MIP08441.hyp Sequence
Translation from 2 to 154
> MIP08441.hyp
FIGRIQIVSTGMKVFGTILMLAILALDVCNAVKCVLTCRTSAGDYEVIEI
*
MIP08441.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43251-PA | 39 | CG43251-PA | 1..39 | 12..50 | 196 | 100 | Plus |