Clone MIP08441 Report

Search the DGRC for MIP08441

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:84
Well:41
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43251-RA
Protein status:MIP08441.pep: gold
Sequenced Size:276

Clone Sequence Records

MIP08441.complete Sequence

276 bp assembled on 2009-03-14

GenBank Submission: BT072907.1

> MIP08441.complete
AGTTTATTGGGAGAATTCAAATAGTTAGCACCGGTATGAAAGTCTTCGGA
ACTATTCTTATGTTGGCAATTTTAGCCCTAGATGTGTGCAATGCAGTAAA
ATGTGTTTTAACTTGTCGTACATCGGCTGGCGACTACGAAGTCATTGAGA
TATAAGTTGTGTGCAATCTTTAAAACTATAAACTATAGATTCGCTTTAAC
GGAGCTTAAAATGAATGTTGGATAATTCTGCAATAAAATATATACTGGAT
TCAAAAAAAAAAAAAAAAAAAAAAAA

MIP08441.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:27:05
Subject Length Description Subject Range Query Range Score Percent Strand
DMG8-chr3L.36.005.a 412 DMG8-chr3L.36.005.a 27..282 1..256 1265 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20748028..20748213 66..251 915 99.5 Plus
chr3L 24539361 chr3L 20747903..20747968 1..66 330 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:09:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20759006..20759196 66..256 940 99.5 Plus
3L 28110227 3L 20758881..20758946 1..66 330 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20752106..20752296 66..256 940 99.4 Plus
3L 28103327 3L 20751981..20752046 1..66 330 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:47:57 has no hits.

MIP08441.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:48:55 Download gff for MIP08441.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20747903..20747968 1..66 100 -> Plus
chr3L 20748029..20748213 67..252 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:02:58 Download gff for MIP08441.complete
Subject Subject Range Query Range Percent Splice Strand
CG43251-RA 1..120 36..155 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:38 Download gff for MIP08441.complete
Subject Subject Range Query Range Percent Splice Strand
CG43251-RA 1..120 36..155 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:02:58 Download gff for MIP08441.complete
Subject Subject Range Query Range Percent Splice Strand
CG43251-RA 1..249 3..252 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:38 Download gff for MIP08441.complete
Subject Subject Range Query Range Percent Splice Strand
CG43251-RA 1..249 3..252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:48:55 Download gff for MIP08441.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20758881..20758946 1..66 100 -> Plus
3L 20759007..20759191 67..252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:48:55 Download gff for MIP08441.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20758881..20758946 1..66 100 -> Plus
3L 20759007..20759191 67..252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:48:55 Download gff for MIP08441.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20758881..20758946 1..66 100 -> Plus
3L 20759007..20759191 67..252 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:02:58 Download gff for MIP08441.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20751981..20752046 1..66 100 -> Plus
arm_3L 20752107..20752291 67..252 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:14:58 Download gff for MIP08441.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20751981..20752046 1..66 100 -> Plus
3L 20752107..20752291 67..252 99   Plus

MIP08441.pep Sequence

Translation from 2 to 154

> MIP08441.pep
FIGRIQIVSTGMKVFGTILMLAILALDVCNAVKCVLTCRTSAGDYEVIEI
*

MIP08441.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG43251-PA 39 CG43251-PA 1..39 12..50 196 100 Plus

MIP08441.hyp Sequence

Translation from 2 to 154

> MIP08441.hyp
FIGRIQIVSTGMKVFGTILMLAILALDVCNAVKCVLTCRTSAGDYEVIEI
*

MIP08441.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG43251-PA 39 CG43251-PA 1..39 12..50 196 100 Plus