Clone MIP08648 Report

Search the DGRC for MIP08648

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:86
Well:48
Vector:pOT2|pOTB7_DraIII
Associated Gene/Transcript14-3-3epsilon-RA
Protein status:MIP08648.pep: gold
Sequenced Size:1204

Clone Sequence Records

MIP08648.complete Sequence

1204 bp assembled on 2009-08-11

GenBank Submission: BT099556.1

> MIP08648.complete
AGAAGGCGACGAACCACAGGCAGCAAGCAAAATCGACGCCGCACGTACCG
GGAGCATTTAAATAATTTTTTCTGTGGATTAATTTTACCGAAAAGGCTTC
AACACAATGACTGAGCGCGAGAACAATGTGTACAAGGCAAAGCTGGCCGA
ACAGGCCGAGCGCTACGACGAAATGGTGGAGGCCATGAAGAAGGTCGCCT
CCATGGACGTAGAGCTGACCGTCGAGGAGCGAAATCTGCTGTCGGTGGCG
TACAAGAATGTGATTGGAGCACGCCGTGCCTCGTGGCGCATCATCACCTC
GATCGAACAGAAGGAGGAGAACAAGGGGGCCGAGGAGAAATTGGAGATGA
TCAAAACCTACCGCGGACAGGTGGAGAAGGAGCTGCGCGACATCTGCTCG
GATATACTGAACGTGCTCGAGAAGCATCTCATTCCATGCGCCACATCCGG
CGAAAGCAAAGTATTCTACTATAAGATGAAGGGCGACTACCATCGCTACC
TGGCCGAATTCGCCACCGGCTCCGACCGCAAGGATGCGGCAGAGAACTCG
CTGATTGCCTACAAGGCGGCCAGCGATATTGCCATGAACGATCTGCCACC
AACACACCCCATCCGTTTGGGCTTGGCATTGAACTTCTCGGTGTTCTACT
ATGAGATTCTCAACTCGCCGGACCGCGCTTGCCGCTTGGCGAAAGCCGCT
TTCGATGATGCCATTGCCGAGTTGGATACACTGAGCGAAGAGAGCTACAA
AGACTCGACACTCATCATGCAGCTGCTGCGCGACAACCTCACATTATGGA
CGTCCGATATGCAGGCAGAAGAAGTAGACCCCAACGCAGGTGATGGCGAG
CCCAAAGAGCAAATCCAGGATGTTGAGGATCAGGACGTGTCGTAATTTAA
GTAAACCCCCGCCCTTCCATTTAAAACACATTATATACCTTCTAAAGTAA
ATATAATACCATATAATATATATGCATACAACAACAACAACAAAATCAAC
AACAACACGACAACAACTTCAAGAACAACAACATGGAACCAATGCGGCAA
CAACAACCATAGCAGTCGATCACCACAACAGCAGCACCCGTATGTGTATC
AACATATTTGCAACATGATAACAGCAAGCAAAGCAGCAGGAACACAAATT
GTCATCCACAATAAACAGCAGGAAAACAACAGCACAAAAAAAAAAAAAAA
AAAA

MIP08648.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
14-3-3epsilon.bc 3629 14-3-3epsilon.bc 378..1581 1..1203 5950 99.7 Plus
14-3-3epsilon.ag 3419 14-3-3epsilon.ag 240..1443 1..1203 5950 99.7 Plus
14-3-3epsilon.ay 3477 14-3-3epsilon.ay 378..1581 1..1203 5950 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14071726..14072199 170..643 2370 100 Plus
chr3R 27901430 chr3R 14072506..14072873 819..1185 1790 99.7 Plus
chr3R 27901430 chr3R 14072264..14072445 640..821 910 100 Plus
chr3R 27901430 chr3R 14067034..14067203 1..170 850 100 Plus
chr2R 21145070 chr2R 5995017..5995123 701..807 280 84.1 Plus
chr2R 21145070 chr2R 5993556..5993651 599..694 195 80.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:10:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18247432..18247905 170..643 2370 100 Plus
3R 32079331 3R 18248212..18248597 819..1203 1850 99.2 Plus
3R 32079331 3R 18247970..18248151 640..821 910 100 Plus
3R 32079331 3R 18242740..18242909 1..170 850 100 Plus
2R 25286936 2R 10107470..10107576 701..807 280 84.1 Plus
2R 25286936 2R 10106006..10106101 599..694 210 81.2 Plus
2R 25286936 2R 10106354..10106449 599..694 210 81.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:26:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17988263..17988736 170..643 2370 100 Plus
3R 31820162 3R 17989043..17989428 819..1203 1860 99.2 Plus
3R 31820162 3R 17988801..17988982 640..821 910 100 Plus
3R 31820162 3R 17983571..17983740 1..170 850 100 Plus
2R 25260384 2R 10108669..10108775 701..807 280 84.1 Plus
2R 25260384 2R 10107553..10107648 599..694 210 81.2 Plus
2R 25260384 2R 10107205..10107300 599..694 210 81.2 Plus
Blast to na_te.dros performed on 2019-03-16 02:18:31 has no hits.

MIP08648.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:19:34 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14067034..14067203 1..170 100 -> Plus
chr3R 14071727..14072196 171..640 100 -> Plus
chr3R 14072265..14072445 641..821 100 -> Plus
chr3R 14072509..14072664 822..977 100 == Plus
chr3R 14072721..14072873 1034..1185 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:45 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RA 1..789 107..895 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:58:02 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RA 1..789 107..895 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:44:18 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RA 1..789 107..895 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:04:36 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RA 1..789 107..895 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-11 16:30:45 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RA 210..1395 1..1185 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:58:02 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RA 210..1395 1..1185 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:44:18 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RA 54..1239 1..1185 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:04:36 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RA 54..1239 1..1185 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:19:34 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18247971..18248151 641..821 100 -> Plus
3R 18248215..18248579 822..1185 99   Plus
3R 18242740..18242909 1..170 100 -> Plus
3R 18247433..18247902 171..640 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:19:34 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18247971..18248151 641..821 100 -> Plus
3R 18248215..18248579 822..1185 99   Plus
3R 18242740..18242909 1..170 100 -> Plus
3R 18247433..18247902 171..640 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:19:34 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18247971..18248151 641..821 100 -> Plus
3R 18248215..18248579 822..1185 99   Plus
3R 18242740..18242909 1..170 100 -> Plus
3R 18247433..18247902 171..640 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:44:18 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14068462..14068631 1..170 100 -> Plus
arm_3R 14073155..14073624 171..640 100 -> Plus
arm_3R 14073693..14073873 641..821 100 -> Plus
arm_3R 14073937..14074301 822..1185 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:49:39 Download gff for MIP08648.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17988264..17988733 171..640 100 -> Plus
3R 17988802..17988982 641..821 100 -> Plus
3R 17989046..17989410 822..1185 99   Plus
3R 17983571..17983740 1..170 100 -> Plus

MIP08648.hyp Sequence

Translation from 106 to 894

> MIP08648.hyp
MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYK
NVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDI
LNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLI
AYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFD
DAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDGEPK
EQIQDVEDQDVS*

MIP08648.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
14-3-3epsilon-PA 262 CG31196-PA 1..262 1..262 1331 100 Plus
14-3-3epsilon-PB 261 CG31196-PB 1..261 1..262 1314 99.6 Plus
14-3-3epsilon-PD 260 CG31196-PD 1..260 1..262 1309 99.2 Plus
14-3-3epsilon-PC 256 CG31196-PC 1..256 1..262 1282 97.7 Plus
14-3-3zeta-PI 248 CG17870-PI 5..245 3..245 829 67.1 Plus

MIP08648.pep Sequence

Translation from 106 to 894

> MIP08648.pep
MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYK
NVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDI
LNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAENSLI
AYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFD
DAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDGEPK
EQIQDVEDQDVS*

MIP08648.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23073-PA 263 GF23073-PA 1..263 1..262 1331 96.2 Plus
Dana\GF12019-PA 248 GF12019-PA 5..245 3..245 843 66.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22781-PA 262 GG22781-PA 1..262 1..262 1389 100 Plus
Dere\GG24140-PA 248 GG24140-PA 5..245 3..245 853 66.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18560-PA 260 GH18560-PA 1..260 1..262 1338 96.9 Plus
Dgri\GH21250-PA 248 GH21250-PA 5..245 3..245 843 66.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
14-3-3epsilon-PA 262 CG31196-PA 1..262 1..262 1331 100 Plus
14-3-3epsilon-PB 261 CG31196-PB 1..261 1..262 1314 99.6 Plus
14-3-3epsilon-PD 260 CG31196-PD 1..260 1..262 1309 99.2 Plus
14-3-3epsilon-PC 256 CG31196-PC 1..256 1..262 1282 97.7 Plus
14-3-3zeta-PI 248 CG17870-PI 5..245 3..245 829 67.1 Plus
14-3-3zeta-PA 248 CG17870-PA 5..245 3..245 829 67.1 Plus
14-3-3zeta-PG 248 CG17870-PG 5..245 3..245 829 67.1 Plus
14-3-3zeta-PH 248 CG17870-PH 5..245 3..245 829 67.1 Plus
14-3-3zeta-PB 248 CG17870-PB 5..245 3..245 829 67.1 Plus
14-3-3zeta-PL 248 CG17870-PL 5..245 3..245 827 66.7 Plus
14-3-3zeta-PK 248 CG17870-PK 5..245 3..245 827 66.7 Plus
14-3-3zeta-PJ 248 CG17870-PJ 5..245 3..245 827 66.7 Plus
14-3-3zeta-PE 248 CG17870-PE 5..245 3..245 827 66.7 Plus
14-3-3zeta-PD 248 CG17870-PD 5..245 3..245 827 66.7 Plus
14-3-3zeta-PC 248 CG17870-PC 5..245 3..245 824 67.1 Plus
14-3-3zeta-PF 248 CG17870-PF 5..245 3..245 824 67.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24759-PA 260 GI24759-PA 1..260 1..262 1338 96.9 Plus
Dmoj\GI20537-PA 248 GI20537-PA 5..245 3..245 843 66.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21790-PA 262 GL21790-PA 1..262 1..262 1389 100 Plus
Dper\GL17609-PA 248 GL17609-PA 5..245 3..245 843 66.3 Plus
Dper\GL25387-PA 250 GL25387-PA 1..249 1..252 725 56.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16084-PA 262 GA16084-PA 1..262 1..262 1389 100 Plus
Dpse\GA24843-PA 248 GA24843-PA 5..245 3..245 843 66.3 Plus
Dpse\GA22759-PA 250 GA22759-PA 1..249 1..252 733 56.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:49:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15292-PA 262 GM15292-PA 1..262 1..262 1389 100 Plus
Dsec\GM21186-PA 248 GM21186-PA 5..245 3..245 853 66.7 Plus
Dsec\GM12998-PA 138 GM12998-PA 55..136 165..246 387 84.1 Plus
Dsec\GM12998-PA 138 GM12998-PA 5..54 3..52 155 62 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15169-PA 240 GD15169-PA 1..240 23..262 1276 100 Plus
Dsim\GD12271-PA 248 GD12271-PA 5..245 3..245 846 66.3 Plus
Dsim\GD24394-PA 51 GD24394-PA 2..49 184..231 217 83.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22546-PA 260 GJ22546-PA 1..260 1..262 1338 96.9 Plus
Dvir\GJ22386-PA 248 GJ22386-PA 5..245 3..245 841 66.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:49:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22388-PA 260 GK22388-PA 1..260 1..262 1355 98.5 Plus
Dwil\GK21486-PA 248 GK21486-PA 5..245 3..245 843 66.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:49:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25525-PA 256 GE25525-PA 1..256 1..262 1339 97.7 Plus
Dyak\14-3-3zeta-PA 248 GE19338-PA 5..245 3..245 853 66.7 Plus