Clone MIP08683 Report

Search the DGRC for MIP08683

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:86
Well:83
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43249-RA
Protein status:MIP08683.pep: gold
Sequenced Size:342

Clone Sequence Records

MIP08683.complete Sequence

342 bp assembled on 2009-03-30

GenBank Submission: BT081364.1

> MIP08683.complete
CCGTTGATAACACTACAAATGGATTACCTGTTGAAAGCGATATTTGTTCT
AATCCTTCTGAGCATCCACTGCACCAATGGATATGTTAATGGCCGCCACG
AGATAGTCAGAAGGGAGGTGAACGTGACAGAGGTGGATCGCGGATTGAGT
GGAGCACTAACCATGTTTTTCCAGCCCCTTGCTGATTTTGCTGCCAAGTT
AAAGATGGAGATACCCATGATTACACACTTCCGCACCAAACATTTTAACT
AATGTATTGTTTTAATTGTAAAAAAAGTGATTTAAAATGTTTTTAGCCTG
TATTATTAAAAACGTTTAAATCAGAAAAAAAAAAAAAAAAAA

MIP08683.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
MB8.chr3L.pasa.54.a 354 MB8.chr3L.pasa.54.a 31..354 1..324 1620 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16294091..16294376 39..324 1430 100 Plus
chr3L 24539361 chr3L 16293996..16294034 1..39 195 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:10:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16304377..16304663 39..325 1435 100 Plus
3L 28110227 3L 16304282..16304320 1..39 195 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16297477..16297763 39..325 1435 100 Plus
3L 28103327 3L 16297382..16297420 1..39 195 100 Plus
Blast to na_te.dros performed 2019-03-16 05:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 1321..1395 321..244 103 62.8 Minus

MIP08683.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:07:00 Download gff for MIP08683.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16294092..16294376 40..324 100   Plus
chr3L 16293996..16294034 1..39 100 -> Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:38 Download gff for MIP08683.complete
Subject Subject Range Query Range Percent Splice Strand
CG43249-RA 1..234 19..252 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:57:35 Download gff for MIP08683.complete
Subject Subject Range Query Range Percent Splice Strand
CG43249-RA 1..234 19..252 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:38 Download gff for MIP08683.complete
Subject Subject Range Query Range Percent Splice Strand
CG43249-RA 1..324 1..324 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:57:35 Download gff for MIP08683.complete
Subject Subject Range Query Range Percent Splice Strand
CG43249-RA 1..324 1..324 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:07:00 Download gff for MIP08683.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16304282..16304320 1..39 100 -> Plus
3L 16304378..16304662 40..324 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:07:00 Download gff for MIP08683.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16304282..16304320 1..39 100 -> Plus
3L 16304378..16304662 40..324 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:07:00 Download gff for MIP08683.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16304282..16304320 1..39 100 -> Plus
3L 16304378..16304662 40..324 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:38 Download gff for MIP08683.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16297382..16297420 1..39 100 -> Plus
arm_3L 16297478..16297762 40..324 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:17:04 Download gff for MIP08683.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16297478..16297762 40..324 100   Plus
3L 16297382..16297420 1..39 100 -> Plus

MIP08683.pep Sequence

Translation from 0 to 251

> MIP08683.pep
PLITLQMDYLLKAIFVLILLSIHCTNGYVNGRHEIVRREVNVTEVDRGLS
GALTMFFQPLADFAAKLKMEIPMITHFRTKHFN*

MIP08683.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG43249-PA 77 CG43249-PA 1..77 7..83 398 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14618-PA 77 GD14618-PA 1..77 7..83 288 80.5 Plus

MIP08683.hyp Sequence

Translation from 0 to 251

> MIP08683.hyp
PLITLQMDYLLKAIFVLILLSIHCTNGYVNGRHEIVRREVNVTEVDRGLS
GALTMFFQPLADFAAKLKMEIPMITHFRTKHFN*

MIP08683.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG43249-PA 77 CG43249-PA 1..77 7..83 398 100 Plus