MIP08683.complete Sequence
342 bp assembled on 2009-03-30
GenBank Submission: BT081364.1
> MIP08683.complete
CCGTTGATAACACTACAAATGGATTACCTGTTGAAAGCGATATTTGTTCT
AATCCTTCTGAGCATCCACTGCACCAATGGATATGTTAATGGCCGCCACG
AGATAGTCAGAAGGGAGGTGAACGTGACAGAGGTGGATCGCGGATTGAGT
GGAGCACTAACCATGTTTTTCCAGCCCCTTGCTGATTTTGCTGCCAAGTT
AAAGATGGAGATACCCATGATTACACACTTCCGCACCAAACATTTTAACT
AATGTATTGTTTTAATTGTAAAAAAAGTGATTTAAAATGTTTTTAGCCTG
TATTATTAAAAACGTTTAAATCAGAAAAAAAAAAAAAAAAAA
MIP08683.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:28:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MB8.chr3L.pasa.54.a | 354 | MB8.chr3L.pasa.54.a | 31..354 | 1..324 | 1620 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:06:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 16294091..16294376 | 39..324 | 1430 | 100 | Plus |
chr3L | 24539361 | chr3L | 16293996..16294034 | 1..39 | 195 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:10:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:06:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 16304377..16304663 | 39..325 | 1435 | 100 | Plus |
3L | 28110227 | 3L | 16304282..16304320 | 1..39 | 195 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 16297477..16297763 | 39..325 | 1435 | 100 | Plus |
3L | 28103327 | 3L | 16297382..16297420 | 1..39 | 195 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 05:06:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Stalker2 | 7672 | Stalker2 STALKER2 7672bp | 1321..1395 | 321..244 | 103 | 62.8 | Minus |
MIP08683.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:07:00 Download gff for
MIP08683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 16294092..16294376 | 40..324 | 100 | | Plus |
chr3L | 16293996..16294034 | 1..39 | 100 | -> | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:38 Download gff for
MIP08683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43249-RA | 1..234 | 19..252 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:57:35 Download gff for
MIP08683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43249-RA | 1..234 | 19..252 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:38 Download gff for
MIP08683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43249-RA | 1..324 | 1..324 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:57:35 Download gff for
MIP08683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43249-RA | 1..324 | 1..324 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:07:00 Download gff for
MIP08683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16304282..16304320 | 1..39 | 100 | -> | Plus |
3L | 16304378..16304662 | 40..324 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:07:00 Download gff for
MIP08683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16304282..16304320 | 1..39 | 100 | -> | Plus |
3L | 16304378..16304662 | 40..324 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:07:00 Download gff for
MIP08683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16304282..16304320 | 1..39 | 100 | -> | Plus |
3L | 16304378..16304662 | 40..324 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:38 Download gff for
MIP08683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 16297382..16297420 | 1..39 | 100 | -> | Plus |
arm_3L | 16297478..16297762 | 40..324 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:17:04 Download gff for
MIP08683.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16297478..16297762 | 40..324 | 100 | | Plus |
3L | 16297382..16297420 | 1..39 | 100 | -> | Plus |
MIP08683.pep Sequence
Translation from 0 to 251
> MIP08683.pep
PLITLQMDYLLKAIFVLILLSIHCTNGYVNGRHEIVRREVNVTEVDRGLS
GALTMFFQPLADFAAKLKMEIPMITHFRTKHFN*
MIP08683.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43249-PA | 77 | CG43249-PA | 1..77 | 7..83 | 398 | 100 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:16:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14618-PA | 77 | GD14618-PA | 1..77 | 7..83 | 288 | 80.5 | Plus |
MIP08683.hyp Sequence
Translation from 0 to 251
> MIP08683.hyp
PLITLQMDYLLKAIFVLILLSIHCTNGYVNGRHEIVRREVNVTEVDRGLS
GALTMFFQPLADFAAKLKMEIPMITHFRTKHFN*
MIP08683.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:38:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43249-PA | 77 | CG43249-PA | 1..77 | 7..83 | 398 | 100 | Plus |