Clone MIP08973 Report

Search the DGRC for MIP08973

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:89
Well:73
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42656-RA
Protein status:MIP08973.pep: gold
Sequenced Size:306

Clone Sequence Records

MIP08973.complete Sequence

306 bp assembled on 2009-03-17

GenBank Submission: BT072923.1

> MIP08973.complete
AGTAAGATTTGGGACACTCAGCTGGACAAGTCGAAATGGATGCACTTCTG
AAAATTGTCTTGTTGATCAGCTTGTATTTCATTGCAATAAGCCTGCACTT
GGGATTGTGTGACGATGTTCCTTCCGCCGAGGCAGACACAGTGGTAACTG
AAAGTGAAGAGCACTACACCGCATCCGATGACTTCGACTATTAGGTGTTA
CGAACAAATCCCCATTAAGTTCAATCATGAGTAAATAAATGAACAATCTT
TCAGCAAAAAAAAAAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAAAAAAA
AAAAAA

MIP08973.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
DMG8-chr3R.6.013.a 417 DMG8-chr3R.6.013.a 83..338 1..256 1280 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3319013..3319202 256..67 950 100 Minus
chr3R 27901430 chr3R 3319255..3319324 70..1 350 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:10:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7492960..7493149 256..67 950 100 Minus
3R 32079331 3R 7493202..7493271 70..1 350 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7233791..7233980 256..67 950 100 Minus
3R 31820162 3R 7234033..7234102 70..1 350 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:51:38 has no hits.

MIP08973.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:52:48 Download gff for MIP08973.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3319014..3319198 71..255 100 <- Minus
chr3R 3319255..3319324 1..70 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:40:44 Download gff for MIP08973.complete
Subject Subject Range Query Range Percent Splice Strand
CG42656-RA 1..159 36..194 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:40:12 Download gff for MIP08973.complete
Subject Subject Range Query Range Percent Splice Strand
CG42656-RA 1..159 36..194 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:42:04 Download gff for MIP08973.complete
Subject Subject Range Query Range Percent Splice Strand
CG42656-RA 1..159 36..194 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:40:44 Download gff for MIP08973.complete
Subject Subject Range Query Range Percent Splice Strand
CG42656-RA 1..255 1..255 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:40:12 Download gff for MIP08973.complete
Subject Subject Range Query Range Percent Splice Strand
CG42656-RA 1..255 1..255 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:42:04 Download gff for MIP08973.complete
Subject Subject Range Query Range Percent Splice Strand
CG42656-RA 1..255 1..255 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:52:48 Download gff for MIP08973.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7492961..7493145 71..255 100 <- Minus
3R 7493202..7493271 1..70 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:52:48 Download gff for MIP08973.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7492961..7493145 71..255 100 <- Minus
3R 7493202..7493271 1..70 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:52:48 Download gff for MIP08973.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7492961..7493145 71..255 100 <- Minus
3R 7493202..7493271 1..70 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:40:12 Download gff for MIP08973.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3318683..3318867 71..255 100 <- Minus
arm_3R 3318924..3318993 1..70 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:15:07 Download gff for MIP08973.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7233792..7233976 71..255 100 <- Minus
3R 7234033..7234102 1..70 100   Minus

MIP08973.pep Sequence

Translation from 35 to 193

> MIP08973.pep
MDALLKIVLLISLYFIAISLHLGLCDDVPSAEADTVVTESEEHYTASDDF
DY*

MIP08973.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG42656-PA 52 CG42656-PA 1..52 1..52 262 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14824-PA 285 GE14824-PA 234..285 1..52 263 96.2 Plus

MIP08973.hyp Sequence

Translation from 35 to 193

> MIP08973.hyp
MDALLKIVLLISLYFIAISLHLGLCDDVPSAEADTVVTESEEHYTASDDF
DY*

MIP08973.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG42656-PA 52 CG42656-PA 1..52 1..52 262 100 Plus