MIP08973.complete Sequence
306 bp assembled on 2009-03-17
GenBank Submission: BT072923.1
> MIP08973.complete
AGTAAGATTTGGGACACTCAGCTGGACAAGTCGAAATGGATGCACTTCTG
AAAATTGTCTTGTTGATCAGCTTGTATTTCATTGCAATAAGCCTGCACTT
GGGATTGTGTGACGATGTTCCTTCCGCCGAGGCAGACACAGTGGTAACTG
AAAGTGAAGAGCACTACACCGCATCCGATGACTTCGACTATTAGGTGTTA
CGAACAAATCCCCATTAAGTTCAATCATGAGTAAATAAATGAACAATCTT
TCAGCAAAAAAAAAAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAAAAAAA
AAAAAA
MIP08973.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:27:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
DMG8-chr3R.6.013.a | 417 | DMG8-chr3R.6.013.a | 83..338 | 1..256 | 1280 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:51:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 3319013..3319202 | 256..67 | 950 | 100 | Minus |
chr3R | 27901430 | chr3R | 3319255..3319324 | 70..1 | 350 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:10:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 7492960..7493149 | 256..67 | 950 | 100 | Minus |
3R | 32079331 | 3R | 7493202..7493271 | 70..1 | 350 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 7233791..7233980 | 256..67 | 950 | 100 | Minus |
3R | 31820162 | 3R | 7234033..7234102 | 70..1 | 350 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 07:51:38 has no hits.
MIP08973.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:52:48 Download gff for
MIP08973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 3319014..3319198 | 71..255 | 100 | <- | Minus |
chr3R | 3319255..3319324 | 1..70 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:40:44 Download gff for
MIP08973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42656-RA | 1..159 | 36..194 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:40:12 Download gff for
MIP08973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42656-RA | 1..159 | 36..194 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:42:04 Download gff for
MIP08973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42656-RA | 1..159 | 36..194 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:40:44 Download gff for
MIP08973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42656-RA | 1..255 | 1..255 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:40:12 Download gff for
MIP08973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42656-RA | 1..255 | 1..255 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:42:04 Download gff for
MIP08973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42656-RA | 1..255 | 1..255 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:52:48 Download gff for
MIP08973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7492961..7493145 | 71..255 | 100 | <- | Minus |
3R | 7493202..7493271 | 1..70 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:52:48 Download gff for
MIP08973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7492961..7493145 | 71..255 | 100 | <- | Minus |
3R | 7493202..7493271 | 1..70 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:52:48 Download gff for
MIP08973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7492961..7493145 | 71..255 | 100 | <- | Minus |
3R | 7493202..7493271 | 1..70 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:40:12 Download gff for
MIP08973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 3318683..3318867 | 71..255 | 100 | <- | Minus |
arm_3R | 3318924..3318993 | 1..70 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:15:07 Download gff for
MIP08973.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7233792..7233976 | 71..255 | 100 | <- | Minus |
3R | 7234033..7234102 | 1..70 | 100 | | Minus |
MIP08973.pep Sequence
Translation from 35 to 193
> MIP08973.pep
MDALLKIVLLISLYFIAISLHLGLCDDVPSAEADTVVTESEEHYTASDDF
DY*
MIP08973.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42656-PA | 52 | CG42656-PA | 1..52 | 1..52 | 262 | 100 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:49:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE14824-PA | 285 | GE14824-PA | 234..285 | 1..52 | 263 | 96.2 | Plus |
MIP08973.hyp Sequence
Translation from 35 to 193
> MIP08973.hyp
MDALLKIVLLISLYFIAISLHLGLCDDVPSAEADTVVTESEEHYTASDDF
DY*
MIP08973.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:26:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42656-PA | 52 | CG42656-PA | 1..52 | 1..52 | 262 | 100 | Plus |