Clone MIP09177 Report

Search the DGRC for MIP09177

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:91
Well:77
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptMtnA-RA
Protein status:MIP09177.pep: gold
Sequenced Size:749

Clone Sequence Records

MIP09177.complete Sequence

749 bp assembled on 2009-03-30

GenBank Submission: BT081369.1

> MIP09177.complete
AGAGCATCTGGCCAATGTGCATCAGTTGTGGTCAGCAGCAAAATCAAGTG
AATCATCTCAGTGCAACTAAAGGCCTAAATAGCCCATACCTACCTTTTTT
GTAAACAAGTGAACAAGTTCGAGGAAATACAACTCAATCAAGATGCCTTG
CCCATGCGGAAGCGGATGCAAATGCGCCAGCCAGGCCACCAAGGGATCCT
GCAACTGCGGATCTGACTGCAAGTGCGGCGGCGACAAGAAATCCGCCTGC
GGCTGCTCCGAGTGAGCTTTCCCCCAAAAAAGATCTGGAGTAGAGGCGCT
GCATCTTGTCTCTCTACACACCCTGCAATAAATGTCCAATTAAAGTAATT
GATGCCTAACTGCGTCTTTTCGGGTTGCATAATCAATTGGTCTGCGGCAT
TCTAGGTTAGATTCGCTTTTATTGGAGGTAGCTTCTAGCTACGTGGTCGG
CAATATGCGTCGTGGAAATGGGATGGTCAAGTGTTTTCCACAATGTGCAT
ATACATATGTACATAACACTAAAGTCAGTTGAGCAATATGGTAATCTGAG
ATGCCTCACTTCTGAAGCGACTGAGGGATTGAGTTTCAAAGCACAGCGGC
TTGAACTCATGACTTGTAGATAAAAATACAGTTGCGGGCGTTAGAATATA
GCCGCTATCGAATGGATAATATTAAAGAATACTAGCTTTAGAAATAATAA
AAATATATTACCCTATCACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP09177.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
MtnA.d 845 MtnA.d 97..814 1..718 3590 100 Plus
MtnA.c 850 MtnA.c 97..814 1..718 3590 100 Plus
MtnA.b 877 MtnA.b 97..814 1..718 3590 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5609242..5609796 718..164 2775 100 Minus
chr3R 27901430 chr3R 5610059..5610223 165..1 825 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:10:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9783406..9783960 718..164 2775 100 Minus
3R 32079331 3R 9784223..9784387 165..1 825 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9524237..9524791 718..164 2775 100 Minus
3R 31820162 3R 9525054..9525218 165..1 825 100 Minus
Blast to na_te.dros performed 2019-03-16 10:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 136..189 657..707 119 72.2 Plus

MIP09177.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:38:05 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5609241..5609795 165..719 99 <- Minus
chr3R 5610060..5610223 1..164 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:47 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 1..123 143..265 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:42:19 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 1..123 143..265 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:45:13 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 1..123 143..265 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:13:34 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 1..123 143..265 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:55 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 1..343 17..359 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:42:19 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RA 1..343 17..359 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:45:13 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RB 1..700 18..717 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:13:34 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
MtnA-RB 1..700 18..717 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:38:05 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9784224..9784387 1..164 100   Minus
3R 9783405..9783959 165..719 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:38:05 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9784224..9784387 1..164 100   Minus
3R 9783405..9783959 165..719 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:38:05 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9784224..9784387 1..164 100   Minus
3R 9783405..9783959 165..719 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:45:13 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5609127..5609681 165..719 99 <- Minus
arm_3R 5609946..5610109 1..164 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:17:02 Download gff for MIP09177.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9524236..9524790 165..719 99 <- Minus
3R 9525055..9525218 1..164 100   Minus

MIP09177.pep Sequence

Translation from 142 to 264

> MIP09177.pep
MPCPCGSGCKCASQATKGSCNCGSDCKCGGDKKSACGCSE*

MIP09177.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\MtnA-PA 40 GF17152-PA 1..40 1..40 172 95 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\MtnA-PA 40 GG17325-PA 1..40 1..40 171 95 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
MtnA-PB 40 CG9470-PB 1..40 1..40 245 100 Plus
MtnA-PA 40 CG9470-PA 1..40 1..40 245 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24880-PA 40 GI24880-PA 1..40 1..40 151 85 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23229-PA 40 GL23229-PA 1..40 1..40 149 77.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\MtnA-PA 40 GA21812-PA 1..40 1..40 149 77.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\MtnA-PA 40 GM26211-PA 1..40 1..40 169 95 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\MtnA-PA 40 GD20757-PA 1..40 1..40 175 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\MtnA-PA 41 GJ24522-PA 1..39 1..39 153 84.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11122-PA 41 GK11122-PA 1..39 1..39 154 87.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\MtnA-PA 40 GE24728-PA 1..40 1..40 170 92.5 Plus

MIP09177.hyp Sequence

Translation from 467 to 622

> MIP09177.hyp
MGWSSVFHNVHIHMYITLKSVEQYGNLRCLTSEATEGLSFKAQRLELMTC
R*
Sequence MIP09177.hyp has no blast hits.