Clone MIP09730 Report

Search the DGRC for MIP09730

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:97
Well:30
Vector:pOT2
Associated Gene/TranscriptCG43448-RA
Protein status:MIP09730.pep: gold
Sequenced Size:548

Clone Sequence Records

MIP09730.complete Sequence

548 bp assembled on 2009-06-19

GenBank Submission: BT072991.2

> MIP09730.complete
GTAAATCAGTCGCAATGAAAAGCTATCTGCTGCTGGGCATATTATTACTA
TATTATCTGTGCATTGATGGACGGAGTGCTGAGATCAAAGAGGAAAGCGA
CAATCCGAGCACAAATATACTTAGCACAACGCTTTCGAAAATTTCTCTGC
AGAACATAACCCGTCTCAATAGATCAAGTTTGGGTGGACGCGTACAAACT
GATCACTTGGGAAGAAATCGGATTTACCATCGGAGAAGAGTTCAAACTAG
ACGTCGAAGAACGAACAAAAATAAGCCCAAACATAAACATTCTCTATAGG
AAGTAGCTTAAATAAAGATACTTTCATGATCCAAACTGTACTAGTAGCTA
CAAGTAGTTTTTAGTTAAACTTCTACACAAAATGTAGACCCATATCCCCA
GAAATATGCAATTGCGAATTGCCTGGGACGCGACTGTACCCAACTGTGAA
CAACAGTGCAGTCATCCCACGCACGTGGCCACCAAATGAAGAGTAAATAA
AATCCCAGTCCTGACTCCCAGGATCCTTCAAAAAAAAAAAAAAAAAAA

MIP09730.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:32:16 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26059589..26059967 529..151 1790 98.2 Minus
chr3R 27901430 chr3R 26060137..26060229 93..1 465 100 Minus
chr3R 27901430 chr3R 26060023..26060084 152..91 280 96.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:11:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:04:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30237093..30237472 530..151 1900 100 Minus
3R 32079331 3R 30237642..30237734 93..1 465 100 Minus
3R 32079331 3R 30237528..30237589 152..91 310 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29977924..29978303 530..151 1900 100 Minus
3R 31820162 3R 29978473..29978565 93..1 465 100 Minus
3R 31820162 3R 29978359..29978420 152..91 310 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:05:00 has no hits.

MIP09730.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:06:15 Download gff for MIP09730.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26060138..26060229 1..92 100   Minus
chr3R 26060023..26060082 93..152 96 <- Minus
chr3R 26059589..26059965 153..529 98 <- Minus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:26:26 Download gff for MIP09730.complete
Subject Subject Range Query Range Percent Splice Strand
CG43448-RA 1..285 15..299 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:18:01 Download gff for MIP09730.complete
Subject Subject Range Query Range Percent Splice Strand
CG43448-RA 1..285 15..299 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:26:26 Download gff for MIP09730.complete
Subject Subject Range Query Range Percent Splice Strand
CG43448-RA 1..529 1..529 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:18:01 Download gff for MIP09730.complete
Subject Subject Range Query Range Percent Splice Strand
CG43448-RA 1..529 1..529 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:06:15 Download gff for MIP09730.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30237094..30237470 153..529 100 <- Minus
3R 30237528..30237587 93..152 100 <- Minus
3R 30237643..30237734 1..92 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:06:15 Download gff for MIP09730.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30237094..30237470 153..529 100 <- Minus
3R 30237528..30237587 93..152 100 <- Minus
3R 30237643..30237734 1..92 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:06:15 Download gff for MIP09730.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30237094..30237470 153..529 100 <- Minus
3R 30237528..30237587 93..152 100 <- Minus
3R 30237643..30237734 1..92 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:26:26 Download gff for MIP09730.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26062816..26063192 153..529 100 <- Minus
arm_3R 26063250..26063309 93..152 100 <- Minus
arm_3R 26063365..26063456 1..92 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:23:57 Download gff for MIP09730.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29977925..29978301 153..529 100 <- Minus
3R 29978359..29978418 93..152 100 <- Minus
3R 29978474..29978565 1..92 100   Minus

MIP09730.pep Sequence

Translation from 2 to 298

> MIP09730.pep
KSVAMKSYLLLGILLLYYLCIDGRSAEIKEESDNPSTNILSTTLSKISLQ
NITRLNRSSLGGRVQTDHLGRNRIYHRRRVQTRRRRTNKNKPKHKHSL*

MIP09730.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG43448-PA 94 CG43448-PA 1..94 5..98 479 100 Plus

MIP09730.hyp Sequence

Translation from 2 to 298

> MIP09730.hyp
KSVAMKSYLLLGILLLYYLCIDGRSAEIKEESDNPSTNILSTTLSKISLQ
NITRLNRSSLGGRVQTDHLGRNRIYHRRRVQTRRRRTNKNKPKHKHSL*

MIP09730.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG43448-PA 94 CG43448-PA 1..94 5..98 479 100 Plus