Clone MIP10514 Report

Search the DGRC for MIP10514

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:104
Well:14
Vector:pOTB7_DraIII
Associated Gene/TranscriptObp50a-RA
Protein status:MIP10514.pep: gold
Sequenced Size:692

Clone Sequence Records

MIP10514.complete Sequence

692 bp assembled on 2009-05-19

GenBank Submission: BT083461.1

> MIP10514.complete
AGTTGATCTTTTCATGTCATCTCTTTGATAGCCGCACGCAAACATATTTC
TCCGCAATAAAATTGTATCATTCGGCGGTTGTAGCTTTAGTTATGCGGAC
AGGGCGTATACTTGTTGCTTTGATTTTTCTAGGTTTAATAATTCCCTTTC
GGGCTGCAAAGTGCAGGGCAGCGCCCAAATCTGTGCAAAATGTACACGTT
TGTTGCTCAGCACCCCTGCCTAACTGGGGAGTTTTCAACAGAGAGTGTCA
TAAATCGGCCATTCAAGCAAGTTGCCGTTTAGATTGCGATTTCAATGCCA
GCTCGGTTCTGCAGGGAAATCGATTGATCCAAGCGAAAGTTCGACCCATG
TTGGAGCGCGCCTTTTCCAACGAACCCACCATCGATGCATATGAGTCCAA
CTTTGCCAAATGTTCAACGGTGGTCAGGAGCAAATACCAGGAGCTATCTC
CGCTGAGTCGTCAAAGCGACGCCTGTGACAGACACGCCCTCTTCTACAGC
CTTTGTGCGTATGCTCGCTTGATTTTCACCTGTCCGGACAAAATGTGGCA
AAGAAATAACAGGATGTGCCAGGAGGCCAAGGCCTATGCGAAAAAATGTC
CTTGGCCAGCGCTAAAAATGTTTATGAGGAATACCTAAAAGAAGTTAATA
CAAATGCCAGTTATAGTAATGAAAAAAAAAAAAAAAAAAAAA

MIP10514.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Obp50a-RA 671 Obp50a-RA 1..671 1..671 3355 100 Plus
Obp50a-RB 603 Obp50a-RB 238..603 273..638 1830 100 Plus
Obp50a-RB 603 Obp50a-RB 1..180 93..272 900 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:12:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10257635..10258033 671..273 1995 100 Minus
chr2R 21145070 chr2R 10258233..10258420 188..1 940 100 Minus
chr2R 21145070 chr2R 10258091..10258179 272..184 430 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:12:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14370330..14370729 672..273 2000 100 Minus
2R 25286936 2R 14370929..14371116 188..1 940 100 Minus
2R 25286936 2R 14370787..14370875 272..184 430 98.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14371529..14371928 672..273 2000 100 Minus
2R 25260384 2R 14372128..14372315 188..1 940 100 Minus
2R 25260384 2R 14371986..14372074 272..184 430 98.8 Minus
Blast to na_te.dros performed on 2019-03-15 21:12:46 has no hits.

MIP10514.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:13:59 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10257635..10258033 273..671 100 <- Minus
chr2R 10258091..10258174 189..272 100 <- Minus
chr2R 10258233..10258420 1..188 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:31 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50a-RA 1..546 93..638 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:46:18 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50a-RA 1..546 93..638 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:40:01 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50a-RA 1..546 93..638 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:45:53 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50a-RA 1..546 93..638 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-19 18:15:01 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50a-RA 1..546 93..638 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:46:17 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50a-RA 1..671 1..671 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:40:01 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50a-RA 1..671 1..671 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:53 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50a-RA 1..671 1..671 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:13:59 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14370331..14370729 273..671 100 <- Minus
2R 14370787..14370870 189..272 100 <- Minus
2R 14370929..14371116 1..188 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:13:59 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14370331..14370729 273..671 100 <- Minus
2R 14370787..14370870 189..272 100 <- Minus
2R 14370929..14371116 1..188 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:13:59 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14370331..14370729 273..671 100 <- Minus
2R 14370787..14370870 189..272 100 <- Minus
2R 14370929..14371116 1..188 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:40:01 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10258292..10258375 189..272 100 <- Minus
arm_2R 10258434..10258621 1..188 100   Minus
arm_2R 10257836..10258234 273..671 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:21:37 Download gff for MIP10514.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14371530..14371928 273..671 100 <- Minus
2R 14371986..14372069 189..272 100 <- Minus
2R 14372128..14372315 1..188 100   Minus

MIP10514.hyp Sequence

Translation from 2 to 637

> MIP10514.hyp
LIFSCHLFDSRTQTYFSAIKLYHSAVVALVMRTGRILVALIFLGLIIPFR
AAKCRAAPKSVQNVHVCCSAPLPNWGVFNRECHKSAIQASCRLDCDFNAS
SVLQGNRLIQAKVRPMLERAFSNEPTIDAYESNFAKCSTVVRSKYQELSP
LSRQSDACDRHALFYSLCAYARLIFTCPDKMWQRNNRMCQEAKAYAKKCP
WPALKMFMRNT*

MIP10514.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
Obp50a-PA 181 CG30067-PA 1..181 31..211 972 100 Plus
Obp50a-PB 200 CG30067-PB 1..200 31..211 942 90.5 Plus
Obp50d-PA 173 CG30074-PA 1..170 36..199 170 24.6 Plus

MIP10514.pep Sequence

Translation from 2 to 637

> MIP10514.pep
LIFSCHLFDSRTQTYFSAIKLYHSAVVALVMRTGRILVALIFLGLIIPFR
AAKCRAAPKSVQNVHVCCSAPLPNWGVFNRECHKSAIQASCRLDCDFNAS
SVLQGNRLIQAKVRPMLERAFSNEPTIDAYESNFAKCSTVVRSKYQELSP
LSRQSDACDRHALFYSLCAYARLIFTCPDKMWQRNNRMCQEAKAYAKKCP
WPALKMFMRNT*

MIP10514.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11354-PA 180 GF11354-PA 1..180 31..211 731 73.5 Plus
Dana\GF13501-PA 193 GF13501-PA 14..180 37..200 175 28.2 Plus
Dana\GF13502-PA 177 GF13502-PA 12..171 45..199 148 26.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22428-PA 181 GG22428-PA 1..181 31..211 855 87.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22122-PA 175 GH22122-PA 1..175 37..211 574 61.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Obp50a-PA 181 CG30067-PA 1..181 31..211 972 100 Plus
Obp50a-PB 200 CG30067-PB 1..200 31..211 942 90.5 Plus
Obp50d-PA 173 CG30074-PA 1..170 36..199 170 24.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19255-PA 179 GI19255-PA 6..179 41..211 604 64.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11403-PA 171 GL11403-PA 20..171 60..211 559 67.1 Plus
Dper\GL10690-PA 187 GL10690-PA 19..186 38..199 145 24.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp50a-PA 171 GA15619-PA 6..171 46..211 568 68.1 Plus
Dpse\Obp50d-PA 187 GA15625-PA 19..186 38..199 145 24.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20215-PA 180 GM20215-PA 1..180 31..211 900 92.8 Plus
Dsec\GM21538-PA 173 GM21538-PA 1..170 36..199 158 25.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp50a-PA 155 GD25686-PA 1..154 31..184 777 92.2 Plus
Dsim\Obp50d-PA 173 GD11048-PA 1..170 36..199 164 25.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp50a-PA 179 GJ20334-PA 6..179 40..211 576 63.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21837-PA 182 GK21837-PA 4..182 35..211 551 57.5 Plus
Dwil\GK19396-PA 179 GK19396-PA 4..173 36..202 178 29.1 Plus
Dwil\GK21475-PA 167 GK21475-PA 7..158 54..201 158 28 Plus
Dwil\GK21472-PA 195 GK21472-PA 1..180 29..199 149 24.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12317-PA 181 GE12317-PA 1..181 31..211 864 88.4 Plus
Dyak\GE13583-PA 173 GE13583-PA 9..170 43..199 156 26.3 Plus