Clone MIP10537 Report

Search the DGRC for MIP10537

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:104
Well:37
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG13557-RA
Protein status:MIP10537.pep: gold
Sequenced Size:465

Clone Sequence Records

MIP10537.complete Sequence

465 bp assembled on 2009-07-30

GenBank Submission: BT089008.1

> MIP10537.complete
CAAACAGTTATGGTCTCCAAGTGGCTGCGCATCTTGGTTCTATTTCTTCT
GGGTCTTGCAACCTCGCGGGCCTCCCTATTTCGCTCCGAGTCGCCGAAAC
CACAGTTGAGCTGGTGGCACAAACAGTACTACCAGTCGCTATGGCAACAG
AGGCTGCGGTTTACGACGACTCCCCGGCCAGGAGCCACTCCCGAATCGGA
TGAAGCCAGATTGGTGTATCCCTGCTACTGCTACAAGCCAACTCCCGAGG
GCTTGGCCACTGCCAGTCCGGTGGAGCAGCGAATGATTGAGACCAAGGAA
ATATTCTTCTTGAACAAATAGTGAGATGTGCGGTAATGATGTATGTACAC
AACGATATGTAGTCGAAATAAAACAGGTAAAGTGTTCATTAGGAAAAAGT
AAATAAACTCGTTGCGGGATTTCCGTACAATCTGTCCGAAAAAAAAAAAA
AAAAAAAAAAAAAAA

MIP10537.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13557-RA 571 CG13557-RA 97..532 1..436 2180 100 Plus
CG13557.b 903 CG13557.b 40..475 1..436 2180 100 Plus
CG13557.a 1368 CG13557.a 40..475 1..436 2180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19361977..19362270 436..143 1410 98.6 Minus
chr2R 21145070 chr2R 19362555..19362697 143..1 715 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:12:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23475698..23475991 436..143 1470 100 Minus
2R 25286936 2R 23476276..23476418 143..1 715 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23476897..23477190 436..143 1470 100 Minus
2R 25260384 2R 23477475..23477617 143..1 715 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:41:22 has no hits.

MIP10537.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:42:04 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19362556..19362697 1..142 100   Minus
chr2R 19361975..19362270 143..438 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:11 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 1..312 10..321 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:52:54 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 1..312 10..321 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:16 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 1..312 10..321 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:17:05 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 1..312 10..321 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-30 10:04:10 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 1..312 10..321 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:52:53 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 1..436 1..436 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:16 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 1..436 1..436 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:17:05 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
CG13557-RA 1..436 1..436 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:42:04 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23476277..23476418 1..142 100   Minus
2R 23475696..23475991 143..438 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:42:04 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23476277..23476418 1..142 100   Minus
2R 23475696..23475991 143..438 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:42:04 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23476277..23476418 1..142 100   Minus
2R 23475696..23475991 143..438 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:16 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19363219..19363514 143..438 99 <- Minus
arm_2R 19363800..19363941 1..142 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:43:45 Download gff for MIP10537.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23476913..23477208 143..438 99 <- Minus
2R 23477494..23477635 1..142 100   Minus

MIP10537.hyp Sequence

Translation from 0 to 320

> MIP10537.hyp
QTVMVSKWLRILVLFLLGLATSRASLFRSESPKPQLSWWHKQYYQSLWQQ
RLRFTTTPRPGATPESDEARLVYPCYCYKPTPEGLATASPVEQRMIETKE
IFFLNK*

MIP10537.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13557-PA 103 CG13557-PA 1..103 4..106 553 100 Plus

MIP10537.pep Sequence

Translation from 0 to 320

> MIP10537.pep
QTVMVSKWLRILVLFLLGLATSRASLFRSESPKPQLSWWHKQYYQSLWQQ
RLRFTTTPRPGATPESDEARLVYPCYCYKPTPEGLATASPVEQRMIETKE
IFFLNK*

MIP10537.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11844-PA 85 GF11844-PA 17..74 24..82 175 59.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20027-PA 103 GG20027-PA 1..103 4..106 413 84.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13557-PA 103 CG13557-PA 1..103 4..106 553 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19018-PA 96 GI19018-PA 25..96 35..106 196 54.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17557-PA 100 GL17557-PA 6..100 12..106 262 55.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12360-PA 100 GA12360-PA 6..100 12..106 263 52.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15539-PA 96 GM15539-PA 1..96 4..106 472 90.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25043-PA 96 GD25043-PA 1..96 4..106 413 89.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19980-PA 105 GJ19980-PA 35..105 36..106 236 60.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19218-PA 105 GK19218-PA 6..105 5..106 263 48 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11563-PA 103 GE11563-PA 1..103 4..106 439 87.4 Plus