MIP10907.complete Sequence
584 bp assembled on 2009-10-08
GenBank Submission: BT099981.1
> MIP10907.complete
ATTATTTTACACTTTCTTAGGACTTCATTTGTTTGAATTACTTGTCACAA
TTTTGACGACTTAACATTTTGTAATACTGTATGGAATGAAATGAATGAAT
CCACACCAAGTAACTGCAGCACACGAAACACACAAATACCAATTCGAGCG
GTTCTCAGACAGACCAGGGAAAGTTTAACTGAGATCTTTACCAAGTATCG
CCAAAAAGTGGGCAATGGAGCTCTCCTGGCGGTTCAAAGGGTCAAAACTT
CTCAACAATTAAGTCTTATAAAGCCAAGCCTTCGTTGTGTAACCAAACGA
CAGAGTTTCTTTAAACGATATGGATGCGAAGAGGTGGCCACTGTGTGCCT
TTTGGTGGTCATTTTGTTGATGCTCTTGTTTGGACTTTACCTGGCCAGGA
ACTACAATCACGCCTATATCTATGGCTCTGGTGGATGCCTTTCGACGTTT
TTGTGGACATACGATGAATGCCAAATAATTACATAGGCCCAAACGGTTTT
GTTTGTATATGAACTTTATTGATGCCCGATTGGTTGTGGCCAATAAACTG
ATAGCAATTCAAAAAAAAAAAAAAAAAAAAAAAA
MIP10907.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:53:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34245.a | 747 | CG34245.a | 1..561 | 1..561 | 2805 | 100 | Plus |
CG34245-RB | 579 | CG34245-RB | 125..250 | 305..430 | 630 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:01:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 14884192..14884496 | 305..1 | 1525 | 100 | Minus |
chr3L | 24539361 | chr3L | 14883814..14884070 | 560..304 | 1285 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:12:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:01:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 14894112..14894416 | 305..1 | 1525 | 100 | Minus |
3L | 28110227 | 3L | 14893733..14893990 | 561..304 | 1290 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 14887212..14887516 | 305..1 | 1525 | 100 | Minus |
3L | 28103327 | 3L | 14886833..14887090 | 561..304 | 1290 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 05:01:39 has no hits.
MIP10907.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:02:46 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 14883814..14884068 | 306..560 | 100 | <- | Minus |
chr3L | 14884192..14884496 | 1..305 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:57:04 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34245-RB | 118..250 | 296..430 | 97 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:41:38 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34245-RD | 1..396 | 91..486 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:42 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34245-RD | 1..396 | 91..486 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:53:13 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34245-RD | 1..396 | 91..486 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-08 16:59:35 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34245-RB | 118..250 | 296..430 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:41:38 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34245-RD | 1..560 | 1..560 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:42 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34245-RD | 1..560 | 1..560 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:53:13 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34245-RD | 1..560 | 1..560 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:02:46 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14893734..14893988 | 306..560 | 100 | <- | Minus |
3L | 14894112..14894416 | 1..305 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:02:46 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14893734..14893988 | 306..560 | 100 | <- | Minus |
3L | 14894112..14894416 | 1..305 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:02:46 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14893734..14893988 | 306..560 | 100 | <- | Minus |
3L | 14894112..14894416 | 1..305 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:42 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 14886834..14887088 | 306..560 | 100 | <- | Minus |
arm_3L | 14887212..14887516 | 1..305 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:23:12 Download gff for
MIP10907.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14886834..14887088 | 306..560 | 100 | <- | Minus |
3L | 14887212..14887516 | 1..305 | 100 | | Minus |
MIP10907.pep Sequence
Translation from 90 to 485
> MIP10907.pep
MNESTPSNCSTRNTQIPIRAVLRQTRESLTEIFTKYRQKVGNGALLAVQR
VKTSQQLSLIKPSLRCVTKRQSFFKRYGCEEVATVCLLVVILLMLLFGLY
LARNYNHAYIYGSGGCLSTFLWTYDECQIIT*
MIP10907.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:30:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13703-PA | 131 | GG13703-PA | 5..131 | 4..131 | 404 | 68 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34245-PD | 131 | CG34245-PD | 1..131 | 1..131 | 677 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:30:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24524-PA | 101 | GM24524-PA | 22..101 | 47..131 | 216 | 71.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:30:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD12593-PA | 150 | GD12593-PA | 42..150 | 23..131 | 443 | 93.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:30:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19998-PA | 101 | GE19998-PA | 27..101 | 52..131 | 197 | 63.7 | Plus |
MIP10907.hyp Sequence
Translation from 90 to 485
> MIP10907.hyp
MNESTPSNCSTRNTQIPIRAVLRQTRESLTEIFTKYRQKVGNGALLAVQR
VKTSQQLSLIKPSLRCVTKRQSFFKRYGCEEVATVCLLVVILLMLLFGLY
LARNYNHAYIYGSGGCLSTFLWTYDECQIIT*
MIP10907.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:25:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34245-PD | 131 | CG34245-PD | 1..131 | 1..131 | 677 | 100 | Plus |