Clone MIP11220 Report

Search the DGRC for MIP11220

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:112
Well:20
Vector:pOTB7_DraIII
Associated Gene/TranscriptCib2-RB
Protein status:MIP11220.pep: gold
Sequenced Size:968

Clone Sequence Records

MIP11220.complete Sequence

968 bp assembled on 2009-06-26

GenBank Submission: BT088880.1

> MIP11220.complete
GTCAGTTGCCATTCACGCTTGGGACTAACCGGTTTGGCCGGCAGCTACGC
AAAAAAAGCAAACCAATCCAAACGGATTCGAGCCAAAACGAACCGAACCC
AACTGGCTGGCGAGTAACGATGGGCAACAAAGTTGTGACATTTACGGAAC
AGGAATTGGATGACTACCAGGATTGCACGTTCTTCACGCGCAAGGAGATC
CTGCGGGTTCACAAGCGATTCCGTGAGCTGCGGCCGGATCTGGTGCCTCG
CCAAATGACCGAAGGTCAGGCCTCCAGTGTTAAGGTGCCCTGCGAATGCA
TTGAGAAGATGCCCGAGTTGCGTGAGAATCCCTTTCGCCGGCGAATATGC
GAGGCCTTCTCACGCGATGGCCAGGGCAATTTATCCTTTGAGGACTTTCT
GGACGCCCTCTCCGTTTTTAGCGAGCAGGCGCCGAGGGACATTAAAGTTT
TCTACGCTTTCAAAATTTATGATTTCGATCAGGACGGCTTCATCGGGCAC
GCCGACCTCATGTCCTGCCTGACAACAATGACCAAGAACGAGCTGAGTCC
GGAGGAGCACCAGCAGATTGCCGACAAGGTAATCGAGGAGGCCGACGTCG
ATGGCGATGGCAAGTTATCAATTTTGGAGTTCGAGCACGTTATACTCCGG
GCGCCCGACTTTCTATCCACCTTTCACATCAGAATATGAAACCGTCTTTC
GCCAGCGGTGCACTGAGAGAAACTAATGCCAGTATGGCATTCTCTAGTGT
TAAATAAAATATTAATATATCAACAGATTGCCTTCACTATTTGGGTTACT
TGTCTCAACTGCACCAAGAAGCTATTCAATTTAGTTATGTATTCTGCAGT
GTAGTATAATAAAATTACCCAGCTATTGATATCCAATGTGCATCAATATC
CCTCAGTGTTTTCTCTATTTTATTAAATTGTTTATGTGCGCTTTTGCGAA
AAAAAAAAAAAAAAAAAA

MIP11220.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG9236.d 1097 CG9236.d 319..1097 169..947 3895 100 Plus
CG9236.f 1419 CG9236.f 641..1419 169..947 3895 100 Plus
CG9236.j 1426 CG9236.j 319..1097 169..947 3895 100 Plus
CG9236.d 1097 CG9236.d 73..243 1..171 855 100 Plus
CG9236.f 1419 CG9236.f 395..565 1..171 855 100 Plus
CG9236.j 1426 CG9236.j 73..243 1..171 855 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16768691..16769165 471..947 2260 99.2 Plus
chr2R 21145070 chr2R 16766434..16766604 1..171 855 100 Plus
chr2R 21145070 chr2R 16767264..16767408 205..349 725 100 Plus
chr2R 21145070 chr2R 16767532..16767654 349..471 615 100 Plus
chr2R 21145070 chr2R 16766680..16766717 169..206 190 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:12:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20882187..20882663 471..947 2385 100 Plus
2R 25286936 2R 20879930..20880100 1..171 855 100 Plus
2R 25286936 2R 20880760..20880904 205..349 725 100 Plus
2R 25286936 2R 20881028..20881150 349..471 615 100 Plus
2R 25286936 2R 20880176..20880213 169..206 190 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20883386..20883862 471..947 2385 100 Plus
2R 25260384 2R 20881129..20881299 1..171 855 100 Plus
2R 25260384 2R 20881959..20882103 205..349 725 100 Plus
2R 25260384 2R 20882227..20882349 349..471 615 100 Plus
2R 25260384 2R 20881375..20881412 169..206 190 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:18:59 has no hits.

MIP11220.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:19:48 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16766682..16766716 171..205 100 -> Plus
chr2R 16767265..16767407 206..348 100 -> Plus
chr2R 16767532..16767654 349..471 100 -> Plus
chr2R 16768692..16769165 472..948 94   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:18 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9236-RA 1..51 120..170 100 -> Plus
CG9236-RA 130..648 171..689 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:49:08 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9236-RB 1..570 120..689 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:42:45 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
Cib2-RB 1..570 120..689 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:43:56 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
Cib2-RB 1..570 120..689 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-30 13:55:11 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9236-RA 1..51 120..170 100 -> Plus
CG9236-RA 130..648 171..689 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:49:08 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
CG9236-RB 1..947 1..947 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:42:45 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
Cib2-RB 1..947 1..947 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:43:56 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
Cib2-RB 1..947 1..947 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:19:48 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20880178..20880212 171..205 100 -> Plus
2R 20880761..20880903 206..348 100 -> Plus
2R 20881028..20881150 349..471 100 -> Plus
2R 20879930..20880099 1..170 100 -> Plus
2R 20882188..20882663 472..948 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:19:48 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20880178..20880212 171..205 100 -> Plus
2R 20880761..20880903 206..348 100 -> Plus
2R 20881028..20881150 349..471 100 -> Plus
2R 20879930..20880099 1..170 100 -> Plus
2R 20882188..20882663 472..948 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:19:48 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20880178..20880212 171..205 100 -> Plus
2R 20880761..20880903 206..348 100 -> Plus
2R 20881028..20881150 349..471 100 -> Plus
2R 20879930..20880099 1..170 100 -> Plus
2R 20882188..20882663 472..948 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:42:45 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16768533..16768655 349..471 100 -> Plus
arm_2R 16767435..16767604 1..170 100 -> Plus
arm_2R 16767683..16767717 171..205 100 -> Plus
arm_2R 16768266..16768408 206..348 100 -> Plus
arm_2R 16769693..16770168 472..948 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:24:49 Download gff for MIP11220.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20883387..20883862 472..948 99   Plus
2R 20881129..20881298 1..170 100 -> Plus
2R 20881377..20881411 171..205 100 -> Plus
2R 20881960..20882102 206..348 100 -> Plus
2R 20882227..20882349 349..471 100 -> Plus

MIP11220.hyp Sequence

Translation from 2 to 688

> MIP11220.hyp
QLPFTLGTNRFGRQLRKKSKPIQTDSSQNEPNPTGWRVTMGNKVVTFTEQ
ELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECI
EKMPELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVF
YAFKIYDFDQDGFIGHADLMSCLTTMTKNELSPEEHQQIADKVIEEADVD
GDGKLSILEFEHVILRAPDFLSTFHIRI*

MIP11220.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
Cib2-PB 189 CG9236-PB 1..189 40..228 990 100 Plus
CanB2-PB 170 CG11217-PB 12..157 58..214 256 36.9 Plus
CanB2-PA 170 CG11217-PA 12..157 58..214 256 36.9 Plus
CanB-PB 170 CG4209-PB 12..157 58..214 254 36.9 Plus
CanB-PA 170 CG4209-PA 12..157 58..214 254 36.9 Plus

MIP11220.pep Sequence

Translation from 2 to 688

> MIP11220.pep
QLPFTLGTNRFGRQLRKKSKPIQTDSSQNEPNPTGWRVTMGNKVVTFTEQ
ELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECI
EKMPELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVF
YAFKIYDFDQDGFIGHADLMSCLTTMTKNELSPEEHQQIADKVIEEADVD
GDGKLSILEFEHVILRAPDFLSTFHIRI*

MIP11220.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12205-PA 189 GF12205-PA 1..189 40..228 999 99.5 Plus
Dana\GF13200-PA 170 GF13200-PA 12..157 58..214 261 36.9 Plus
Dana\GF19757-PA 170 GF19757-PA 12..157 58..214 256 36.9 Plus
Dana\GF17404-PA 189 GF17404-PA 1..170 40..210 173 32.4 Plus
Dana\GF22427-PA 187 GF22427-PA 1..168 40..210 159 28.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22065-PA 166 GG22065-PA 1..166 40..228 642 71.1 Plus
Dere\GG23301-PA 170 GG23301-PA 12..157 58..214 261 36.9 Plus
Dere\GG18755-PA 170 GG18755-PA 12..157 58..214 256 36.9 Plus
Dere\GG10903-PA 189 GG10903-PA 1..170 40..210 173 32.4 Plus
Dere\GG20597-PA 1087 GG20597-PA 106..229 108..228 146 28.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22004-PA 189 GH22004-PA 1..189 40..228 976 97.9 Plus
Dgri\GH20317-PA 162 GH20317-PA 4..149 58..214 260 36.9 Plus
Dgri\GH24615-PA 170 GH24615-PA 12..157 58..214 256 36.9 Plus
Dgri\GH19192-PA 189 GH19192-PA 1..170 40..210 169 33.2 Plus
Dgri\GH17717-PA 187 GH17717-PA 1..168 40..210 159 28.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
Cib2-PB 189 CG9236-PB 1..189 40..228 990 100 Plus
CanB2-PB 170 CG11217-PB 12..157 58..214 256 36.9 Plus
CanB2-PA 170 CG11217-PA 12..157 58..214 256 36.9 Plus
CanB-PB 170 CG4209-PB 12..157 58..214 254 36.9 Plus
CanB-PA 170 CG4209-PA 12..157 58..214 254 36.9 Plus
elm-PB 189 CG2185-PB 1..170 40..210 180 32.4 Plus
elm-PA 189 CG2185-PA 1..170 40..210 180 32.4 Plus
Frq1-PE 187 CG5744-PE 1..168 40..210 165 28.2 Plus
Frq1-PD 187 CG5744-PD 1..168 40..210 165 28.2 Plus
Frq1-PC 187 CG5744-PC 1..168 40..210 165 28.2 Plus
Frq1-PB 187 CG5744-PB 1..168 40..210 165 28.2 Plus
Frq2-PD 187 CG5907-PD 1..168 40..210 155 26.7 Plus
Frq2-PC 187 CG5907-PC 1..168 40..210 155 26.7 Plus
Frq2-PB 187 CG5907-PB 1..168 40..210 155 26.7 Plus
Frq2-PA 187 CG5907-PA 1..168 40..210 155 26.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19707-PA 189 GI19707-PA 1..189 40..228 979 97.9 Plus
Dmoj\GI19990-PA 160 GI19990-PA 2..147 58..214 260 36.9 Plus
Dmoj\GI11077-PA 170 GI11077-PA 12..157 58..214 256 36.9 Plus
Dmoj\GI24225-PA 189 GI24225-PA 1..170 40..210 173 32.4 Plus
Dmoj\GI19860-PA 1092 GI19860-PA 106..229 108..228 146 28.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17058-PA 189 GL17058-PA 1..189 40..228 990 98.4 Plus
Dper\GL10837-PA 170 GL10837-PA 12..157 58..214 261 36.9 Plus
Dper\GL14682-PA 170 GL14682-PA 12..157 58..214 256 36.9 Plus
Dper\GL23144-PA 189 GL23144-PA 1..170 40..210 169 32.4 Plus
Dper\GL26964-PA 187 GL26964-PA 1..168 40..210 159 28.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:20:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21632-PA 189 GA21632-PA 1..189 40..228 995 98.9 Plus
Dpse\GA29181-PA 206 GA29181-PA 1..73 85..157 385 98.6 Plus
Dpse\GA18033-PA 170 GA18033-PA 12..157 58..214 256 36.9 Plus
Dpse\GA24505-PA 305 GA24505-PA 148..292 59..214 251 37.2 Plus
Dpse\GA27156-PA 189 GA27156-PA 1..170 40..210 169 32.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:20:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15782-PA 206 GM15782-PA 1..206 40..228 895 83.7 Plus
Dsec\GM20979-PA 170 GM20979-PA 12..157 58..214 261 36.9 Plus
Dsec\GM12403-PA 170 GM12403-PA 12..157 58..214 256 36.9 Plus
Dsec\GM21688-PA 1087 GM21688-PA 106..229 108..228 146 28.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11545-PA 206 GD11545-PA 1..206 40..228 895 83.7 Plus
Dsim\GD15356-PA 170 GD15356-PA 12..157 58..214 261 36.9 Plus
Dsim\GD10507-PA 170 GD10507-PA 12..157 58..214 261 36.9 Plus
Dsim\GD19593-PA 189 GD19593-PA 1..170 40..210 170 32.4 Plus
Dsim\GD24850-PA 187 GD24850-PA 1..168 40..210 159 28.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17436-PA 189 GJ17436-PA 1..189 40..228 979 97.9 Plus
Dvir\GJ21239-PA 177 GJ21239-PA 19..164 58..214 260 36.9 Plus
Dvir\GJ14779-PA 170 GJ14779-PA 12..157 58..214 256 36.9 Plus
Dvir\GJ10797-PA 189 GJ10797-PA 1..170 40..210 171 30.4 Plus
Dvir\GJ18905-PA 1105 GJ18905-PA 106..229 108..228 147 28.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23329-PA 188 GK23329-PA 1..188 40..228 969 97.4 Plus
Dwil\GK21716-PA 170 GK21716-PA 12..157 58..214 261 36.9 Plus
Dwil\GK10056-PA 170 GK10056-PA 12..157 58..214 256 36.9 Plus
Dwil\GK10850-PA 189 GK10850-PA 1..170 40..210 177 33 Plus
Dwil\GK19999-PA 187 GK19999-PA 1..168 40..210 159 28.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12146-PA 166 GE12146-PA 1..166 40..228 642 72.1 Plus
Dyak\GE19147-PA 170 GE19147-PA 12..157 58..214 261 36.9 Plus
Dyak\GE16397-PA 170 GE16397-PA 12..157 58..214 256 36.9 Plus
Dyak\GE24150-PA 189 GE24150-PA 1..170 40..210 173 32.4 Plus
Dyak\GE17711-PA 187 GE17711-PA 1..168 40..210 159 28.3 Plus